illuminati english

june 24, 2013

I’m constantly adding what I learn about the “Illuminati” to this article titled: “Top 10 Things You Shouldn’t Know About the Illuminati.” You can read about it here if interested: http://www.wisdom-square.com/top-10-things-you-shouldnt-know-about-the-illuminati.html

january 12th 2013

ok thanks for your answer
yeha theyd efinitely dont believe in GOD or anything good they are sooo depravated , obviosuly they love and have sex i heard with demons!!!! they must be compeltely retards and crazy and have absolutely no morals, but why lose their times with us, we are mere humans, we are not important this earth isnt either, why do they wana control us , were only a dust in the universe and they actually think itd be cool and exciting to destroy us? they are pathetic little loosers too!!! if we aint nothing, they aint nothing, the devil, the mosnters, the vampires, they all are losers and they give an importance and so much energy in trying to make us suffe, why??? wasting their time, they shud jsut kill themselves, whats the point that they do all this to us? we aint kings or GODS or special, they dont udnerstand that its useless and very cruel and they think its be great to make us slaves and torture us and kill uss all and reign over the earth when theyd be no humans no more, why, whats the point? this earth is cool? no its not, it sucks, they got weird tastes, they give tomuch improtance to this planet. stupid aliens, stupid illuminatis, stupid dev.. dem.... ect

july 20TH 2013

http://www.jesus-is-savior.com/False%20Religions/false_religions.htm

august 1st 2013

Mandy Moore illuminati ?

The El Diablo Satanic Hand Sign
By David J. Stewart

I can't recommend Pastor Texe Marr's materials enough. His research is impeccable and I am so grateful for his labors in the Lord as a born again Christian. I have learned so much from him and hope you'll get his books and listen to Pastor Marrs on YouTube. The following information is from Pastor Texe Marrs' eye-opening website . . .

"People that are Christians now, but were Satanists, recognized President Clinton’s signal at his inauguration as a sign of Satan. That seems fairly cut and dried, and it is. Clinton communicated what he wanted to the people to whom he wanted to communicate. The whole affair with him flashing the satanic hand signal took only a couple of seconds."



"A symbol veils or hides a secret, and it is that which veils mysterious forces. These energies when released can have a potent effect."



PHOTO TO RIGHT: The shameless Mandy Moore plays the main role in one of the most evil, demonic, rotten, God-hating and blasphemous movies ever made, called “SAVED” (2004). Mandy Moore is a genuine loser. As you can see in the picture to the right, Cassandra (played by Eva Amurri) is giving God the Satanic hand sign. The entire movie mocks and desecrates Christianity. At one sick point in the movie, Cassandra looks at the crotch of Jesus on a cross and makes the statement “Now, that's what I call being hung on a cross.”1


Here's the movie transcript if you want to see just how evil Mandy Moore and those other actors really are. Macaulay Culkin also plays in this sicko film, which I'm sure impressed his sicko friend, and high-priest in the Church of Satan, Marylyn Manson. SAVED is not innocent satire; It's blasphemy against the God of the Bible!

—David J. Stewart

END

Manuela, now 23, was first introduced to vampirism and the Goth lifestyle at age 16, when she ran away to London and met up with a secret colony of blood drinking Satanists in that city's north side. Soon, she hooked up with lover Daniel Ruda, another would-be vampire and Satanist. The two got married in a satanic ceremony and went to live in Germany, taking up the dark Goth lifestyle there.

Manuela and Daniel Ruda and their many Goth friends gave the El Diablo hand sign back and forth as a sign of recognition. It was a sign indicating their love and worship of their Master, Lucifer. It also signified their hatred of everything good.

On July 6, 2001, Manuela and Daniel followed what they claim was their Master's order to "kill, sacrifice, bring souls!" The chosen victim, Frank Hackert, 33, "suffered well," bragged Manuela. After inviting the unsuspecting Hackert to their apartment for a satanic party, she and her vampire husband, Daniel, pitilessly stabbed the hapless Hackert a grand total of 66 times on that 6th day of the month (666). They then cut a satanic pentagram (5-point inverted star) in his chest and drank his blood from a bowl on an altar topped with skulls. Afterwards, the two satanic killers celebrated by enjoying sex together as they lay in a silk-lined oak coffin.

They killed for Satan!

Manuela and Daniel Ruda sacrificed a friend to the Devil, stabbing him 66 times. Then, they drank his blood.





Hand Sign The Devil's Calling Card

Strangely, family members and friends not involved in Satanism and vampirism say they did not realize that the hand sign was the devil's calling card. "I thought it was just a fun thing, you know, sorta the kind of cool way kids show they are having an awesome time at a heavy metal concert," said a cousin.

Manuela's mother says she was, however, increasingly disturbed over her daughter's lifestyle. Especially when Manuela had two teeth removed and had metal vampire fangs implanted. She was also taken aback by her daughter's tattoo—an upside down cross on her scalp.

But the hand sign? "Well," she said, "I thought it was like the sign the deaf give, meaning, I love you."

"I often heard Manuela say she was not of this world and was a satanic vampire," recounted her mother, "but I figured it was just so much silly talk. Just another way of living. After all, not every Goth vampire ends up sacrificing victims to Satan."

In the end, it was Manuela's mom who turned the couple in to the police. She was alarmed after her daughter wrote her a letter confessing the crime and showing no remorse whatsoever. Manuela even told her mother she looked forward to serving Satan, her Lord, in hell.

Back to Babylon
In Codex Magica, my latest mammoth exposé book of the Illuminati and their occultic sub-elements, I fully explore the use by Manuela, Daniel, and other occultists of the sign and symbol of El Diablo. It is wildly popular today among legions of depraved men and women, including top Illuminati initiates, and has been now for almost half a century.


Three versions of the "El Diablo," the sign of Satan, the horned god. The hand sign at right is also the deaf’s gesture, or signing, for "I love you," a fact which has many people confused.
Also called Il Cornuto and Diabolicus, the employment by the elite of the hand sign of the horned devil can actually be tracked all the way back to Babylon. On the great wall of Babylon, adjacent to Ishtar's Gate, was a mosaic image of a horned bull, representing the sun god. The horns were symbolic of the Babylonian god's power over the hearts of men.

Later, in Imperial Rome, Caesar's military legions and millions of common people worshipped the sun god, Mithras. Mithraic initiates were baptized in the blood of a horned bull, slain and sacrificed by temple priests.

The Knights Templar, predecessor to today Scottish Rite Freemasons, worshiped the grotesque horned goat god, Baphomet. It is believed that many Illuminists continue to sacrifice to this unspeakable deity to this very day.

Reportedly, the Illuminati take great delight in seeing the masses adopt their ancient symbol of satanic worship on such a vast scale. How easy it has been for the elite to persuade the stupid and gullible to enter into satanic bondage. In giving the El Diablo, that is exactly the message the giver is signaling the Devil: "I'm yours forever, Satan, heart and soul I'm yours!"

I Love You, Devil?

The "El Diablo" hand sign often is con-fused with the deaf's signing of the phrase, "I love you." While at first this appears an odd resemblance, we register an "ahh, I get it!" emotion when we discover that the person who invented, or created, the hand sign system for the deaf, Helen Keller, was herself an occultist and Theosophist. Did Keller purposely design the deaf's "I love you" sign to be such a remarkable imitation of the classic sign of Satan? Was Keller saying, basically, "I love you, Devil?"

Then, we have the confusion of the El Diablo hand sign with the University of Texas "hook 'em horns" sign. Texas' mascot is the longhorn cow and it is only natural that the horns sign be employed by the student body, alumni, and fans of that great institution.

When Jenna Bush, the daughter of President George W. Bush, gave the horns sign at the 2004 presidential inauguration, it shocked the world. Most viewers of international TV did not know that Jenna is a recent graduate of the University of Texas. However, at that same inaugural gala, the President also was photographed giving the sign, and so was the other Bush daughter. Not only that, but the First Lady, Laura, and even the President's mother, Barbara Bush, got into the mix. They, too, were seen giving the sign.

However, the inauguration of President George W. Bush was not the first which had featured the giving of the El Diablo sign. President Bill Clinton also did it at his first inaugural, and, in Codex Magica, you'll see a shocking example of the El Diablo sign of Satan given at the inauguration of George Washington, our nation's very first President!



High priest of the Church of Satan, Anton LaVey, was honored upon his death in this article in the San Francisco Chronicle. In the picture, LaVey is giving the "El Diablo" hand sign while, on the wall, is the "Baphomet" version of the satanic pentagram star. Was it mere coincidence that on the very day that this wicked Satanist died in California, across the sea, in England, Illuminati chief Lord Edmond de Rothschild also passed away?


Marion Berry, then Mayor of the nation’s capital, Washington, D.C. Later arrested for cocaine possession, Mayor Berry once remarked, "Outside of the killings, Washington has one of the lowest crime rates in the country."






President George W. Bush is very adept at giving the sign.


President Bill Clinton is often seen flashing the horned devil sign.






Prince William of Britain’s royal family.



Amy Grant

Partying, Drinking, Rebellion, Or...?

With the rapid rise in popularity of the El Diablo sign among rock music fans, many people seem to be blissfully unaware of the satanic background and dark history of this sign. To some, giving the sign more likely indicates eagerness and gusto for fun, partying, drinking, and rebellion.

I leave it to you, the reader, to decide which of the persons shown here and in my book, Codex Magica, rendering the El Diablo sign, are paying homage to Satan and which are employing it for some other purpose. I have my own opinion, what's yours? For example, in Codex Magica you'll discover former President Bill Clinton, entertainer Michael Jackson, and Italian Prime Minister Silvio Berlusconi all giving the sign. Are they telling us they are Texas Longhorns fans... or that they love Satan?

Actress Meryl Streep gives the sign of the Devil just over the head of "Angels in America" director, Mike Nichols. In 2004, the HBO series "Angels in America" was aired. It was possibly the most evil TV program ever broadcast. The director and actress were given "Golden Globe" awards, indicating how hateful Hollywood and the TV networks have become. The series depicted angels having sex with homosexuals and blasphemously mocked God. It praised communist spies like Ethel Rosenberg. (Photo: Newsweek, November 17, 2003)


Entertainer Michael Jackson sends a message to his fans.



Watch Those Hands! Actor Jason Alexander ("George" in Seinfeld TV series) performs a cabala ritual in plain sight of a vast audience. To the uninitiated and ignorant millions of people who read TV Guide and see this cover, Jason Alexander appears to be merely hamming it up. Little do they know of the deeper occult meaning. For example, we find Jason’s left and right hands giving the "El Diablo" satanic hand sign. His arms—one pointing up, the other down—indicate the dualistic (marriage of opposites, or reconciliation), cabalistic magical philosophy "As Above, So Below" (The devil goat Baphomet performs the same sign). We also note the three triangles presented by Jason’s legs and arms.

Judging the Evidence

A final word: Even if you and I are willing to allow that the giving of this sign by some is not intentionally satanic, we cannot dismiss the evidence that many, if not most, who employ the sign are, in fact, knowingly honoring Satan, the rebellious dark angel. The case of the vampire Satanists who stabbed a victim 66 times and drank his blood undeniably stamps the El Diablo hand sign given by the murderers as intensely satanic in nature.

Neither can the pictures in Codex Magica of a Hindu sect member, a witch, and of Anton LaVey, High Priest of Satan, giving the sign be disputed or explained away.

As for top-ranked Christian evangelists pictured in Codex Magica giving what appears to be the El Diablo sign, are these men servants of the One, True God as revealed in the Holy Bible, or do they cryptically serve His adversary, Lucifer? Judging from their hand gestures, what do you say?

august 1st of 2013

WORSHIPPING SATAN

Revelation 13:4, “And they WORSHIPPED the Dragon”

The following is an excerpt from the "Satanic Bible"...



Horned Hand or The Mano Cornuto:

This gesture is the Satanic salute, a sign of recognition between and allegiance of members of Satanism or other unholy groups.

Worship of Satan or mere coincidence?






Barack and Michelle Obama





Republican vice presidential candidate, Alaska Governor Sarah Palin, with her daughter Willow holding her son Trig, campaigns at a rally in Henderson, Nevada. Notice how Palin makes a Satanic sign with both hands! Boy was she desperate to get elected! Sarah Palin is a sell-out, clearly showing her willingness to spiritually fornicate with the Devil, i.e., "wickedness in high places" (Ephesians 6:12).





Bill Clinton



John Kerry campaigning in October of 2004. Notice the numbers 666! Was this just a coincidence or more of the illuminati's symbolic language which we see so prevalent throughout society?

John Kerry campaigning in October of 2004



Illuminati Devil Hand Signals were Prevalent Throughout the 2005 Inauguration



George W. Bush at his 2005 inauguration



George W. Bush Denies Jesus Christ!

www.Bushrevealed.com



"...For they that are such serve not our Lord Jesus Christ, but their own belly; and by good words and fair speeches deceive the hearts of the simple." —Romans 16:18









The Associated Press and Reuters called the above bush family hand signs, the 'Texas Longhorn or 'Texas UT' symbol. People still seem to think the signal is solely the 'hook 'em horns' UT symbol. We know this to be true but this doesn't answer our primary questions:

1) If the symbol denotes Texas football or UT, why are people like Silvio Berlusconi and Bill Clinton doing it too? They have no links with Texas.

2) Why is the Bush family so obsessed with the signal, displaying it dozens of times during both the inauguration and the evening ball? A few times maybe we could accept, but why this many? What has Texas sports got do with a national inauguration?

3) By Bush being an occult member of Skull and Bones and Bohemian Grove, it certainly shouldn't be surprising that people would suspect him of praising Satan. Why would any Christian belong to an occult organization?



Above: The pictures of Bush and Ahmadinejad giving the Satanic "goat's head" sign suggest Iranians are as ignorant as Americans of their President's true loyalty. Illuminati defector Leo Zagami recently called Ahmaninejad a "well known Satanist with no real connection to Islam" and the Iraq-Iran-Israel conflict a "foreign intelligence show." Empowered by the central banking cartel, the Illuminati Order has the resources to infiltrate both sides of every conflict, and steer it according to the New World Order agenda. They call this a "dialectical process." They were on both sides of both world wars, the Cold War, Korea and Vietnam. Iran's nuclear ambitions are merely a pretext. The real object is to degrade both the US and Iran so citizens will forfeit political, economic and spiritual rights to Illuminati banker "world government." -Read More



In the above photo promoting the evil movie, Saved, Cassandra (played by Eva Amurri) is flashing the Satanic hand-sign to God, blaspheming him. Mandy Moore stars in this mockery film.

Below are some photos where the hand gesture is used in a clearly Satanic context:



This is an album cover by the rock band Dio. The album is called Holy Diver. Dio's singer is former Black Sabbath frontman Ronnie James. The Satan character is clearly displaying the same hand signal. Is he a fan of the Texas Longhorns too?





WOW - even King Abdullah and Putty Pute are fans, everybody's doing it!

Go Long Horns!





France President Sarcozy



Vice President Dick Cheney





Elizabeth Taylor

Elizabeth Taylor

Some people claim that the deaf signal (i.e., a hand sign with the thumb extended) is sign language for 'I love you.' This sign is displayed above by Elizabeth Taylor. However, the inventor of the deaf hand sign, Helen Keller, was herself an occultist and Theosophist. Helen Blavatsky, who founded The Theosophical Society, was a devout Satan worshipper who said...

"Lucifer represents... Life... Thought... Progress... Civilization... Liberty... Independence... Lucifer is the Logos... the Serpent, the Savior." pages 171, 225, 255 (Volume II)

If you think Miss Keller's hand sign is just a coincidence, then you are truly gullible. If you were deaf, and wanted to develop a hand sign to tell someone that you love them, what would it be? A hand over the heart would be reasonable. There is no way that any reasonable person would develop the hand sign that Keller invented, paralleling an existing hand salute to Satan. The above photo is one of Ozzy Osbourne's Rock-n-Roll album covers. It is abundantly clear to see that Keller's hand sign praises the Devil.


So what affiliation does Prince William Have with Texas UT?





Silvio Berlusconi? Paul McCartney? Bill Clinton?





Tommy Franks?





Courtney love with Daughter





Rock band Metallica. Are they all acknowledging Texas UT?







The rock band, Forsaken.





The first image Represents the horned god of witchcraft, Pan or Cernunnos. Note the thumb under the fingers and given by the right hand. The next image is a sign of recognition between those in the Occult. When pointed at someone it is meant to place a curse. Note the thumb over the fingers and given by the left hand.

TAKE A LOOK AT THE FOLLOWING PHOTOS AND DECIDE FOR YOURSELF...


Goat of Mendes -Origin of the Satanic Hand Sign

Satanic Occult Symbols in Washington D.C.




Marvel Comic's "Spider Man"





Prince William





Maria (Kennedy) Shriver at her marriage to Arnold Schwarzenegger





U.S. President George W. Bush





Tom Ridge, former Homeland Security Director

Above: Outgoing Homeland Security Director Tom Ridge (formerly Governor of Pennsylvania).





Senator John Edwards

Above: Former North Carolina Senator John Edwards (also the Democratic Vice Presidential candidate in 2004).





Yasser Arafat





George W. Bush Again





Italian Prime minister Berlusconi





Amy Grant





Anton LaVey, leader and founder of the Church of Satan.

Above: Anton LaVey, founder of the Church of Satan and author of The Satanic Bible, displaying the "Horned Hand" (also called the "satanic salute" and Il Cornuto) with his left hand, on the back cover of The Satanic Bible.



Clark

Harley Clark

Above: Begun in 1955, the `Hook 'em Horns' sign started by Harley Clark still motivates UT fans today. Is it mere coincidence that every Satanist in the world uses the same hand salute?




Dan Quayle

Above: Here is former Vice President Dan Quayle from Indiana showing his horns. Is he a Texas Longhorns fan too?





McDonalds CEO's





A Satanic Ritual

Above: (Satanists making the "Satanic salute" to an altar displaying the Goat of Mendes or Baphomet, to acknowledge their allegiance to Satan, during a Satanic ritual.)





John Lennon is portrayed giving the Satanic hand-signal on "Yellow Submarine"





John Lennon again (bottom right)





Kid Rock (above and below)







Pat Robertson



Benny Hinn

Benny Hinn



Jesse Duplantis

Jesse Duplantis



Rodney Howard Browne

Rodney Howard Browne



Kenneth Copeland

Kenneth Copeland





One of The Council On Foreign Relations symbols features a man naked on a white stead giving the horned hand signal.

Devil Companies

Satan on Our Dollar!

owl.jpg (7742 bytes)

There is a small owl just to the left of the "1" which appears on the upper right hand corner of the Dollar Bill. From time to time politicians like Bill Clinton and George W. Bush have been caught on camera flashing the horned owl symbol with their hands. There is a distinct separation between those in the demonic occult and those involved in the wickedness of witchcraft. The goat is associated strongly with witchcraft and Freemasonry, while the owl is more strongly associated with the occult (e.g., Bohemian grove). There is definitely an inseparable common denominator between the two groups: Satanism.

Goat of Mendes -Origin of the Satanic Hand Sign?

"The Goat of Mendez is the god of the witches. (Mendez is another spelling of Mendes, a city of ancient Egypt where fertility worship - Baal worship -- was practiced). Masons admit readily that Baphomet is a pagan fertility god and, more importantly, that Freemasonry is a fertility cult religion. At any rate, this mockery of Jesus is a satanic symbol and figures prominently in Satan worship." —Kerr Cuhulain (Occult author, police investigator, and friend of witches)

Saturated with Satan | Imagine | Peace Sign and Satanism | Gorbachev an Antichrist


Alex Jones presents his newest film, The Order of Death, an amazing and horrifying look into the occult practices of the global elite featuring never before seen footage of the infamous Bohemian Grove.

MORE HAND SIGNS: SHOWING ALLEGIANCE TO SATAN!

John 8:32,36, “And ye shall know the truth, and the truth shall make you free ... If the Son therefore shall make you free, ye shall be free indeed.”

Jesus Came to Save Sinners


http://www.lovethetruth.com/nwo/worship_dragon.htm

august 1st of 2013

http://www.joy105.com/a-jaw-dropping-joy105-com-exclusive-interview-with-illuminati-author-rebecca-scott-author-of-hip-hop-illuminati/

Joy105 – Spreading the Word!!
Home
Photos
Events
Beauty
Authors
Freebies
Contact Us
Hot Topics!
A jaw dropping Joy105.com Exclusive interview with Illuminati Author Rebecca Scott! (Author of Hip-Hop Illuminati)
FOUNDER FEBRUARY 18, 2013 9
A jaw dropping Joy105.com Exclusive interview with Illuminati Author Rebecca Scott! (Author of Hip-Hop Illuminati)
Joy105.com: Are you a born again believer that loves, fears, revers and worships the Lord and Savior Jesus Christ?

Rebecca Scott: Amen to that! I am most definitely. I am new to the Body of Christ. While I was in the music industry I did not go to church or have a relationship with God. I know now that you can’t serve 2 Masters you have to love one and hate the other. I can say I am saved now and so filled with gratitude for God saving me seeing all the people before me that are no longer here from this industry. I intend to live out the rest of my days as a Christian. I am a walking and talking Christian not just in words!

Joy105.com: Rebecca you have taken on a bold task. Is there any fear of repercussions?

Rebecca Scott: People often ask me am I afraid of being hurt. What I realize is that the people that run the show that are the elite they have 2 methods they either take you down or take you out. So right now, I am not a major threat. When I was still in the industry I was more of a threat then I am now.

Joy105.com: Rebecca the talk of illuminati has been out for a while, but I don’t think people take it seriously. Is it serious?

Rebecca Scott: Most definitely! I almost regret naming my book Hip Hop Illuminati because illuminati far exceed the Hip Hop world. There is so much going on in the world of the illuminati that affects everyone regardless of their spiritual beliefs!

Joy105.com: In what sector of society are the illuminati more prominent?

Rebecca Scott: In most every area. Even in the hood! It’s not by coincidence the hood is flooded with liquor stores. You have more liquor stores than you do churches. They control the weak with alcohol and drugs.

Joy105.com: Rebecca you have stated that some artists are worth more dead than alive? Will you elaborate?

Rebecca Scott: That’s a fact! Having been on the management side of the business I see so many come in and they think this is a party and that because they have a talent that’s all there is to it. It’s a business and once you forget that it becomes a problem. Even with the money the artists are given, the labels expect to recoup their money! It’s not as simple as ok give us a couple of records and we are even! At that point, you are owned it’s a different type of slavery. Not every celebrity death is illuminati related and not every celebrity is a pawn. When they are not producing from a certain level there is no interest!

Joy105.com: You stated Nicki Minaj was inducted into the illuminati?

Rebecca Scott: I based that off of the performance she did with Madonna. Now, when I was in the business I actually knew Madonna. When she got in the industry I was one of the movers and shakers. Madonna was a Midwest girl from Michigan that was a great dancer and really street smart but not really book smart or knowledgeable about the industry.

When she did Like a Prayer there was a signifance to it that was part of her elevation. The demonic principle behind illuminati is they are trying to set up their own kingdom. Madonna is into Kabala which is a Jewish type of witchcraft. In Kabala you have to join and take different oaths and then you still may not be able to join it’s like Scientology your money has to be long! I said all of this to make a connection. Now you have Nicki Minaj who is a part of Cash Money aka Young Money which formed from Universal Records which is ole school illuminati. Now that Nicki is at a certain financial level they want to protect their money. They have to make sure she plays by the rules.

When you look at the performance at the Superbowl it was an induction people think it is just entertainment, but it’s not! A few weeks later Nicki was on stage at the Grammy’s in another demonic performance. Everything about Nicki is fake and her stage name Minaj represents ménage a trois! She is being groomed and being elevated.

Joy105.com: The CNN interview with Chaka Kahn and Pierce Morgan?

Rebecca Scott: Chaka is a person who has been in the industry since her youth and she is still in the business, therefore she was very careful, yet relayed a message. I was really surprised that CNN aired it so it must have been LIVE because the media is controlled by the illuminati. She too had her bout with the industry and drugs.

Joy105.com: Whitney Houston?

Rebecca Scott: I basically co-sign what Chaka Khan said on CNN in that “How in the hell could they continue to have a party while Whitney’s body lay dead upstairs?”


Whitney was either dead before she went under the water or someone held her there until she drowned. I mean we’re talking a bathtub not a Jacuzzi. A person no matter how intoxicated or high cannot drown in a bathtub. I’ve seen people quite inebriated be awakened from a drunken stupor from water simply being splashed on their face much less being totally submerged in it. Even serious heroin addicts (and they’re almost comatose) will awake from a “nod” before they hit the floor much less go underwater. It will be interesting to see what the medical examiner’s final verdict is…

Whitney, just like Amy Winehouse, Elvis, Kurt Cobain and all the other talented entertainers who were addicts at the time of their deaths began to cost their labels money when their addictions took over and were unable to keep bringing in revenue (making records, performing, etc.).

Clive Davis is old school Illuminati and Whitney was deep in debt at the time of her death. Chaka sounded like she had read my book when she said, “These artists are worth more dead than alive.”

Joy105.com: Amy Winehouse?

Rebecca Scott: Amy Winehouse she was showing up to shows high. You have people that are paying their money to see a show they don’t want to see some addict up there slurring lyrics. She started costing the label money…

Joy105.com: Willow Smith?

Rebecca Scott: I saw a picture of Willow Smith and she had all of these different symbols written in black magic marker all over her body. Now let’s look at the parents that are known swingers in Hollywood and Scientologist. We are not paying attention…

Joy105.com: Anna Nicole Smith?

Rebecca Scott: Anna Nicole Smith was married to a wealthy man named Howard Marshall and his sister-in-law was Dorothy Bush Couche (President Bush’s Sister) and Anna Nicole Smith overdosed…

Joy105.com: Marilyn Monroe?

Rebecca Scott: Marilyn Monroe was connected to a President and she supposedly committed suicide…

Joy105.com: Kanye West?

Rebecca Scott: Kanye before his mother died he was very spiritual he had the Jesus Walks song he was very grateful for not dying in the car accident that messed up his face he was very grateful! Now, Kanye offended some very elite people when he made the comment that Bush doesn’t care about black people and other comments. My suspicion is that Donda’s death was payback for that comment! You don’t get on National TV and insult the President! Did you notice his change after Donda died?

Illuminati means to be illuminated! Let’s look at the song Kanye put out called, “All of the lights” it’s all about mind control. The video was a little girl wandering the streets at night by herself it was like homage to selfishness. I want everybody to see me (this).

Joy105.com: Dave Chappell?

Rebecca Scott: He didn’t go crazy he woke up! He realized that Comedy Central though they offered him a 65 million dollar contract in his own words he said, “The show was socially irresponsible.” So he just left the production and went to Africa. There comes a point where if you have any type of ethics and morals you realize this isn’t right.

Joy105.com: Katt Williams?

Rebecca Scott: As you noticed he disappeared! They tried to discredit him and say he went crazy, but Katt got taken out!

If you can function on drugs the powers that be will make sure you keep getting the drugs, but you are not supposed to let the drug stop you from making them money! They don’t care if you get high they hope you kill yourself.

Joy105.com: Jennifer Hudson?

Rebecca Scott: That was a ritual killing! The police reports are available they are public record. Her nephew Julian his hands were cut off and he was shot in the head! It’s one thing to kill a person and another thing to torture someone. He was the only one tortured. In the the satanic rituals children represent sacrifices. Julian was shot in the head, tortured and his hands were cut off. Come on what was the point of that he wasn’t a gansta he was a little kid.

Joy105.com: Rebecca, how did you get out?

Rebecca Scott: No, they took me down! I had an office on West 42nd street the studio that I was using was owned by someone else, but we had full use of it. So one day I went out for coffee and I ran into this woman name Patricia Durst. Her family owned the Durst Corporation and they owned a lot of the property in Times Square and one of the buildings they owned was 4 Times Square. She approached me became very friendly with me and we would meet daily at the same time. Long story short, she offered to give me suite for free since I was renting and sharing an office at the time.

The property is called 4 Times Square now, but then it was called The Durst Building. After I was there a couple of weeks a man came through with some artwork and he stated that Patricia had sent him told him to ask me to keep it in my office until she had time to come and retrieve it. When she came by the following week she asked me if any of my artists were scheduled to go on tour. I pulled out the itinerary and we went over it. The drugs were in the artwork. Long story short I begin to make drops for her while on tour. I must stress my artist were not aware of this! After getting to certain point I decided it was too risky and I did not want to be a part of it anymore. I was making 10,000 per trip. Right before I was taken down Patricia’s brother was arrested in Pennsylvania for cutting his neighbors head off. The week after John Forte from the Fugees got busted for drug trafficking I was busted a week later. They set me up and long story short I did a 10 year term in federal prison. I am now also handicapped.

Joy105.com: How did you become handicapped?

Rebecca Scott: I did 10 years federal time so they sent me to Oregon. I believe the orders were given to make my stay as difficult as possible. I was victimized on almost a daily basis for the first 5 years. I was hated there for 2 reasons. 1.) I was black 2.) I was wealthy at the time. I was put in a cell that was shorter than my height. I am 5’8 the cell must had been 5’5. So I could never stand up right. So after a year being home from prison I noticed my legs were giving out on me and I was diagnosed with muscular dystrophy which I believe is a direct result of my imprisonment.

Rebecca Scott: The illuminati is bigger than the mafia, bigger than the Columbia the reach is very long!

To purchase a copy of this book: http://hiphopilluminati.blogspot.com/




Email Share
TAGS » Anna Nicole Smith, author, Chaka Khan, Hip Hop, Hot Topics, Illuminati, Joy105.com, Kanye West, Marilyn Monroe, nicki minaj, Rebecca Scott, Whitney Houston, Willow SmithPOSTED IN » Exclusive Interview

About the author: Founder View all posts by Founder

Crystal Smith, Founder of www.joy105.com

Twitter - Facebook
Related »

Tyler Perry says small goals will get you there
Tyler Perry says small goals will get you there
Bishop Wiley Jackson says enough is enough!
Bishop Wiley Jackson says enough is enough!
Kierra Sheard living a bold right life!
Kierra Sheard living a bold right life!
A Chicago Pastor pleads guilty to stealing 1.6 million in church funds
A Chicago Pastor pleads guilty to stealing 1.6 million in church funds
9 Comments »


Tomeka Tiller February 29, 2012 at 2:52 pm - Reply
Ok, wow, wow, wow, wow…All I have to say is, I don’t care how big they are, nothing or no one is bigger than God and we all have to answer to him in due time!

Rashawnda Alderman August 4, 2013 at 5:51 pm - Reply
A thief comes only to rob, kill, and destroy. I came so everyone would have life, and have it fully.
John 10:10

John Small Berries March 1, 2012 at 5:39 pm - Reply
Shame on you for enabling this poor woman’s paranoid, self-aggrandizing fantasies.

Stacy Taylor March 4, 2012 at 11:25 pm - Reply
You are the idiot do your research on John Todd and R. Marneau who in the 70′s spoke out as ex illuminati memembers on the illuminatis control over media including all T.V music and films. You will be the one rotting in hell if you dont wake up to Satans wool he has pulled over your eyes.

Esther Morgan March 1, 2012 at 6:16 pm - Reply
I will be praying for you. May God keep you and bless you as you do His will.

Cem November 20, 2012 at 7:28 am - Reply
Aw this was a great video! I’m so glad you could help your son with this crazy move. Seriously, that flood what a nightmare!!!! At least it hnppeaed while all his stuff was still packed up rather than laying everywhere. I hope everything was salvagable. (except the treadmill, lol)

jesus baby March 4, 2012 at 8:43 pm - Reply
Praise God, No weapon that is formed against us shall prosper. You stay in the hands of Jesus and you will be blessed and Highly favored.

illuminate July 15, 2013 at 8:56 am - Reply
Hello, are you interested in world of illuminate?
Getting rich-more powerful and famous?
Email me for more information.
Email: illuminaterichworld@gmail.com
Or contact this mobile:08108978213
Best Regards,
Illuminate World.

Rashawnda Alderman August 4, 2013 at 5:49 pm - Reply
A thief comes only to rob, kill, and destroy. I came so everyone would have life, and have it fully.
John 10:10
Leave A Response »

Name (required)

Email (required)

Website

Comment


Valider
RSS
Subscribe
to RSS Feed
Twitter
137716
Followers
Facebook
36345
Fans
Subscribe to our mailing list!!

Let us Email you Breaking News & Events
Email:
Latest Tweets


joy105-magazine
New Releases!

United Tenors
United Tenors
March 13, 2013, No Comments

Tye Tribbett ” Same God”
Tye Tribbett ” Same God”
February 26, 2013, No Comments

Dottie Peoples “I Got This-Live”
Dottie Peoples “I Got This-Live”
February 7, 2013, 1 Comment

Twinkie Clark ft. Karen Clark Sheard – “Speak Lord”
Twinkie Clark ft. Karen Clark Sheard –
February 2, 2013, 1 Comment

Upcoming Gospel Events! »

Upcoming Gospel Events
Upcoming Gospel Events
July 30, 2013, 3 Comments
TWO ICONIC GRAMMY AWARD WINNING CHOIRS SHARE SAME STAGE FOR THE FIRST TIME
TWO ICONIC GRAMMY AWARD WINNING CHOIRS SHARE SAME STAGE FOR THE FIRST TIME
July 30, 2013, No Comments
Joy Thought!

1 Timothy 3:14,15, KJV "These things write I unto thee, hoping to come unto thee shortly: But if I tarry long, that thou mayest know how thou oughtest to behave thyself in the house of God, which is the church of the living God, the pillar and ground of the truth."
joy105-productions-logo
Featured Video!


Archives


Photos

dsc0105 joy105-65 joy105-93 oprahwinfreyleadershipacademygirlsclassw4p2d5zfgwol
Find us on Facebook


Joy105.com


Copyright © 2011 - Joy105. All rights reserved.Maintained by Printingdreamsinc.comBack to Top

AUGUST 5TH 2013

VIDEO

http://noisey.vice.com/fr/blog/j-cole-talks-skating-rinks-his-artistic-evolution-and-illuminati-decoder-rings

J. COLE TALKS SKATING RINKS, HIS ARTISTIC EVOLUTION, AND ILLUMINATI DECODER RINGS
INTERVIEWS

J. Cole is by far one of the most popular rappers in the United States of America, but for some reason it seems like he never really gets the credit he’s due. The fact of the matter is that J. Cole makes smart, accessible pop-rap in a landscape that rarely rewards such a thing. Though he’s signed with Jay-Z’s Roc Nation and openly and honestly operates within the pop-rap idiom, J. Cole is an auteur in a landscape where major rap albums are assembled by committee. On the eve of a visit to speak at Harvard, J. Cole came to the VICE office to talk to me about his life before fame, his Illuminati decoder ring, and how he finally feels like he’s sounding like himself.

Noisey: Tell me about Harvard.
J. Cole: Harvard. Tomorrow. It’s a pretty fuckin’ huge deal to me, just the fact they would ask me to come and shit.

What are you speaking about?
It’s really on them. The title is called “The Mindstate of a Winner,” and I’ve got some things I wanna talk about in terms of hip-hop and the game, but I’m really gonna leave it up to them. They’ve got a mediator, Henry Louis Gates, who’s mad famous. So I’ll let them direct traffic and get my points in. But it’s not like I thought like “I’ma give a speech,” I thought it was gonna be one of those, you know where at graduation they always got a speaker coming? But I’m fuckin’ excited.

Who gave the commencement speech when you graduated?
George Stephanopoulos. With the huge ears.

What’d he talk about?
Random generic shit that people say when you graduate. Some people get Obama and fuckin’ crazy people. What school did you go to?

UNC.
When did you graduate?

2011.
I wanted to go to Carolina my whole life, son. ‘Til I decided I wanted to go to New York. So I didn’t even apply to Carolina cause I knew if I got accepted, you know what I mean, it would be too much temptation to go, but I wanted to go for a long time.

Well, why did you choose New York?
The music. I knew. And just coming from Fayetteville, when I got to New York I just felt like the energy was somewhere I wanted to be. I knew right away when I first touched down, I was like 13 or 14 years old, I knew.

Tell me about your early days when you had just signed with Roc Nation.
That shit was mad fun. It was so fresh and new. I had just got signed. I don’t think I even had my advance yet, and they were talking about going on tour with Wale, ‘cause Wale was doing a promo tour and had just put his first single. And we would drive down and meet him—we weren’t really on the tour, you know what I mean? So if he was doing the University of Virginia, we would drive to Norfolk, or if he was doing Baltimore, we’d drive down there. So we was following the tour certain places but we weren’t technically on tour. It felt cool, because me and my homeboys would just ride in the car, it would be like four of us in either my little Honda. It was just mad innocent, you know?

We did Norfolk, and after the show, just me and my homeboys went right around the corner to the Karaoke bar, we just went around the corner to the Karaoke bar, doing Michael Jackson and shit, and then Wale walks in. I guess he was walking by and heard us in there. I had more opportunities to do regular shit cause nobody knew who the fuck I was. So it was the best of both worlds, I got to be on stage doing what the fuck I do, then I got the anonymous part, which I love, you know what I mean? That shit is gone forever now.



Do you feel like your privacy is compromised?
Absolutely. I can’t do regular shit anymore. And I definitely enjoyed regular shit. I’m a regular dude. I’m not one of those guys that like his whole life was training to be a rapper. I got friends that haven’t made it yet and their whole lives they been rappers, since they were 12, 13 years old, niggas been callin’ them by their rap names. That wasn’t me, I’ve always just been Jermaine, and rap was my alter ego, you know what I’m saying? And I definitely enjoyed regular life and now that shit is pretty much wrapped up. So fuck it, I’ll do this other shit for the time being.

Do you guys have cookout in Fayetteville? [Editor’s Note: Cookout is a delicious fast food restaurant specifically germane to rural North Carolina.]
Cookout is only North Carolina. I don’t know where it was started, maybe Greensboro, but um, yeah cookout is incredible. We got like four Cookouts now. People don’t know about it. It’s like the best meals for the cheapest prices. You get like a fuckin’ burger, seasoned fries, chicken nuggets, hushpuppies. New York people don’t know about hush puppies. The skating rink is huge where I’m from. That’s all we had, Cookout and the skating rink.

What were they playing at the skating rink?
Top 40 shit on Friday night, and on Saturday nights were hood nights, so it was all rap, and it depends on who’s DJing. And on Sunday night you got old-school R&B, or like the old ‘70s and ‘80s music, and all the old black people come out and skate. Tuesday night you had Christian night. I peeped it, because I used to work at the skating rink and I saw the whole business, how it was run and shit. It’s smart how they do it. Nights for everybody.In the ‘Ville it was like the club, damn near.

Holy shit.
When you hit like maybe twelve, thirteen, it became the hangout spot. You know how in some towns it was like the movie theater or the mall—we had a mall, but the skating rink was the main spot.

What did kids do when they graduated from the skating rink?
Then it was the teen club. So from age thirteen to fifteen it was the skating rink, then when you hit sixteen you go to the teen club. And that’s like from sixteen to eighteen. Actually, at fifteen we started going to the club. That’s one thing that they don’t do in New York that we do back home, is club early. So when I was fifteen and hitting these hole-in-the-wall, nasty, raunchy joints, where kids were doing shit that kids weren’t really supposed to do, you know what I mean? Like, a lot of my first experiences was like, my “Oh shit!” experiences came from going to the teen clubs. That’s something I feel like they don’t do in other places, only some small town shit.

Do you like Lil B?
I don’t know a lot of Lil B but I like what he represents. What, you love Lil B?

For some reason I could just see you liking him. I don’t really know why.
I think a lot of people rode his wave and took it further than he did. You know? I feel like he introduced this counterculture shit, and just being mad weird and different, and I feel like other people came and did that and actually took it further. You know what I mean? So he’s almost the originator for some of these guys.

Are you in the Illuminati?
Yes.

Did they give you an Illuminati decoder ring?
Yes.

Can I see it?
No. I’d have to kill you. But if you want me to kill you, I can show you.

At what point did you realize you were famous?
I haven’t had that moment yet, honestly. There’s been things that should’ve made me have that moment, you know what I mean? Like large crowds of people screaming like, “Oh my God, J.Cole!” or not being able to go anywhere, but I have a hard time appreciating shit in the moment. I feel like when I turn 50, 60, if I make it that far, I’ll probably be disappointed that I didn’t live in the moment more. But for the most part I haven’t had that moment. I recognize it but I haven’t had that, “Whoa, shit, I’m here!” moment, you know what I mean? I feel once you hit that, you start plateau-ing.

You wear a lot of hats. Which one would you consider your main thing?
I was a rapper first, I take a lot of pride in rapping, and I’m mad competitive with rap. So I used to say that. But now I’m realizing that I’m just as competitive as a producer, but I’ve got even more to prove there nobody fuckin’ knows about it. So now I gotta show them. So now I look at myself just an entity.



Describe where your production’s at now.
I hit a zone this past year. It started about a year ago. I remember in my crib, in January. I could hear a clear difference of where I progressed sonically, especially the past four, five months. It’s effortless now, and I’m just following my heart and doing the things I like to do. It’s turning into some of the wildest shit I’ve ever done, and it’s turning into some shit that I can’t point at anything that’s close to it. Back in the days when I made my beats I could be like, “Oh that sounds like a Dre beat,” or, “That sounds like a Kanye beat,” or, “That sounds like a Timbaland beat.” Now I can’t. It’s just a mesh of all this shit.

Now they sound like Cole beats.
Exactly. Which is exactly how I started rapping. The first shit I recorded sounded like Eminem married Nas and had a baby and he made a song and that’s how I sounded. And then my next song sounded like a Canibus clone, and then my next song sounded like this, and before I knew it, in two, three years I had my own sound. And before I knew it, in six years I really had my own style, and that’s how I feel that finally happened with production.

Let’s talk Can-I-Bus, the first Canibus album.
The first album? Aw, man, that was a staple in my life. That changed the way I rap. It was like ’98, and my cousin was from Louisiana—I have this story that I told a million times by now. But I started rapping because he was the coolest dude I knew. He was 16, I was 12, 13. He had all these girls, he could play ball, he was cool, he had a Jesus piece, he had jerseys, and he also used to just freestyle for fun. And so, me just being young and looking up to him, I tried to rap too, like “Yo, teach me how to rap!” So, he showed me a couple of things about how to freestyle or whatever, and then we started writing, and so my first rap sounded like how he was rapping, which sounded like No Limit, Master P, and Cash Money. Long story short, soon after that I heard Canibus, I heard that album, and it totally changed the way I looked at rap. It was harder, it took more thought to be so clever and to have these punchlines and to come up with these things and have people react like “OOOOOH, THAT’S FUCKIN’ CRAZY HE SAID THAT.”



Do you smoke weed?
In the studio. Socially, can’t do it. Fucks me up. I’m too paranoid. I don’t really do it much at all, period. But if I’m feeling extra good, or if I need a different perspective, I smoke maybe a few times a year, just to give me a new outlook. I wish I could smoke. All my homeboys do—I wish I could smoke and just relax like them. I can’t. My mind is already on one thousand and that shit takes it to a million.

That’s what it does for some people.
Smoking hookah actually gives me a more relaxed feeling that I imagine smoking weed does for the average person. Even though you gotta keep smoking hookah all fuckin’ day to maintain that little buzz. But I wish, man. I just watched a documentary on how marijuana affects the brain and shit, but the people they were interviewing—one lady had a full time job, the other two dudes were comedians and they write together, and the other dude was a musician or whatever, and all of them said the same thing, that it helped them mellow out, lean back, feel at ease. I envy that shit. Just liquor for me. Hennessy does the trick.

Do you think 2013 will be the year of the hookah in hip hop?
Probably. Yeah man. It ain’t just hip hop, it’s coming to black culture. If I was an investor, I would invest in fuckin’ hookahs. Cause I definitely see it coming. Drake got the shit in his videos.

Pretty sure Drake has a backpack with a hookah in it at all times.
I found out about it a few years ago because one of my best friends was messing with it. He’s Sudanese, his whole family put me on the hookah years ago so it’s cool to see it catching up.

J. Cole recently announced he'll be returning to his hometown of Fayetteville, NC for his Dreamville Weekend, where he'll be encouraging kids to reach their fullest potential. Events will include a book club reading session, a skating party at local high schools, and a club event.



Drew Millard smoked hookah in college one time. He’s on Twitter - @drewmillard

By Drew Millard 5 months ago
Tags: J. Cole, Cole World, I'm Clumsy I Stay Dropping Interviews
submit 0
MORE FROM NOISEY
Coachella Style Special: People Looking Hot in the Heat
Coachella Style Special: People Looking Hot in the Heat
This New Release Plays on Fisher-Price Record Players ONLY
This New Release Plays on Fisher-Price Record Players ONLY
Listen to Blue Sky Black Death and S.A.S.'s Single &quotValley of Kings," Featuring Cam'ron and N.O.R.E.
Listen to Blue Sky Black Death and S.A.S.'s Single "Valley of Kings," Featuring Cam'ron and N.O.R.E.
Barf Troop is Rap Internet 3.0, Dunked in Girl Power and Sprinkled with Coyness
Barf Troop is Rap Internet 3.0, Dunked in Girl Power and Sprinkled with Coyness
Recommended by
COMMENTER

À L'AFFICHE

Deafheaven is the Hugh Grant of Metal
We interrupted frontman George Clarke's strip club brunch buffet to talk 'Sunbather,' rap, and the prettiest men in metal.

Rod Stewart's "She Makes Me Happy" Is The Worst Love Letter Ever Written
Guess how many people it took to write this song.

Behind the Boards With... Harry Fraud
Get the lowdown on the backend of 'SAAAB Stories.' Plus, did you know this dude plays guitar?

Important Questions Raised by Miley Cyrus' New Video, "We Can't Stop"
Like "Where are your parents?" and "What the fuck?"

Dean Ween
Old friends Matt Sweeney and Dean Ween discuss tasters, solos, and guitar placement relative to genitals.

Watch Phaseone's Trippy Video for "Hunter"
Grab yourself a saddle and get ready to ride a majestic horse.

Ace of Base's Secret Nazi Past
Before he founded Ace of Base, Ulf Ekberg was a member of Commit Suiside, a Nazi punk band.

Parquet Courts - "Light Up Gold Road Trip" (Full Documentary)
In this new documentary, Noisey follows rising indie rockers Parquet Courts from Mexico to Texas and London as they tour to support their debut LP, 'Light Up Gold.'

Yung Lean Doer Is the Weirdest 16-Year-Old White Swedish Rapper You'll Hear This Week
Yung Lean raps over pillow-fluffy beats and raps about glory holes and Arizona Iced Tea. Who the fuck is this kid? And why is he like this?

august 2nd 2013

I’m not in Illuminati cult – D’banj

by RudeBoi /




D’Banj has declared as mere rumour words going round that he had been initiated into the entertainment cult group, Illuminati, by Kanye West in the United States.

The Channel Manager of one of the country’s musical cable network who wants to be anonymous, said the whole thing amuses D’Banj as he understands perfectly how the rumour had started.
“It can’t be far from reaction to the 666 video that’s now in town where Kanye, MJ, Beyonce, Rihanna, Jay-Z and
many others were alleged to be members of the cult group
‘Of course Beyonce was furious when linked to the group, Jay-Z has chosen to be quiet about the whole thing. Same as Kanye.
‘So, when you consider the enviable relationship between Kanye and D’Banj, it should be understood where the story has emanated. In any case, D’Banj has said he finds it amusing, “and silly that some will say he has been initiated into Illuminati. It is not true,” he told the CM.
“He is not even bothered about the story and for now, he does not want to expend energy commenting publicly on it”.
D’Banj has been signed on to Kanye West’s GOOD Music label.
The duo of Don Jazzy and D’Banj reportedly fell apart on Illuminati issues as D’Banj’s romance with Kanye West and Jay Z got stronger.
Meanwhile, one week after the release of D’banj’s new single, Oyato, the song has yet to make an impression despite the hype it has generated.
Club djs and fans appear not to be that impressed with a song that many have taken to be a tacit swipe at Don Jazzy and other artistes on Mavin label.
The single, a follow up “Oliver Twist”, is his first Nigerian release as an independent recording artist. Oyato marks D’banj’s transition into an international music star and ambassador of contemporary Nigerian music.
He, however, praised his fans for their love and support.”An artist without loyal supporters is like a king without a crown, without them, there would be no D’banj, and of course, there would be no “Oyato”, he said.
“Oyato is my special dedication to my fans who have stood by me through it all. Thank you for being there for me”, he added.



dbanj illuminati?
azonto and illuminati
Dbanj is a cultism or not
Is it true that dbang is a cultist
Is Kanye West a cultist?

AUGUST 2ND 2013

VIDEO

http://www.conspiracyarchive.com/Blog/?p=5153

august 2nd 2013
Music’s 10 Newest Illuminati Inductees
Written by TSSCrew / 03.27.13
‹ Prev1 of 11Next ›
Use your ← → keys to navigate
| TWEET
| LIKE241



For musicians, success constitutes a key component of why they began making music in the first place. While there's joy that comes from just having your voice heard, many aspire to take their creations to a higher, more recognizable level, one marked by worldwide recognition and being known as one name entities.

But reaching that peak takes more than talent or even luck. It takes sacrifice, just not the old fashioned blood, sweat and tears variety. Oh, there's blood. And oaths, deep dark secrets and more. Some artists will sell their souls or kill their best friend if it means easy access to success. Getting fast-tracked to the top only comes one way: joining the Illuminati. Yes, The New World Order is the only plausible way these 10 artists skipped to the top of the charts.

Previously - Music’s 5 Newest Illuminati Inductees



Read more: http://smokingsection.uproxx.com/TSS/2013/03/musics-10-new-illuminati-inductees#ixzz2bhfRvJY9

The Vigilant Citizen - Discover the hidden symbolism in music videos, movies and famous landmarks around the world

Search This Site


Home
Read This First
Educate Yourself
E-Mail Signup
Download the VC E-Book
About VC
Contact VC
Latest News
Music Business
Movies and TV
Vigilant Reports
Sinister Sites
Pics of the Month
Viral Videos
Hidden Knowledge






Illuminati Symbolism in former Disney girl Belinda’s “Egoista”

Sep 7th, 2010 | Category: Music Business |397 Comments


In previous articles we have covered Illuminati symbolism found in the music industries of America, Asia and Eastern-Europe. This article looks at the symbolism found in one of Latin America’s major pop stars, Belinda. We’ll examine her past role with Disney’s “Cheetah Girls” and her new video entitled “Egoista”.



In the articles “Narsha and SHINee: Illuminati Infiltration of K-Pop” and Mind Control Symbolism in Russian Pop: Vintage’s “Mikkie”, we discussed the obvious effort to bring to non-English speaking audiences the themes and symbols found in American pop culture, including occult/secret society symbolism, mind control and transhumanism. The agenda aims to transcend national and cultural borders to reach the “global village”.

One of the artists covering the Spanish speaking market is Belinda, a Mexican singer, songwriter and actress born from a Spanish father and French mother. Her music video entitled Egoista, is simply rife with what we call “Illuminati symbolism”, which are the symbols, codes and themes associated with the occult elite’s agenda. We will see in this article that Belinda’s success is however not the result of good luck. Quite to the contrary, she was groomed to propagate the mind control agenda since her youth at the No. 1 school for teenage pop stars: Disney.

Cheetah Girl




In 2006, Belinda appeared in the Disney movie Cheetah Girls 2, a movie about the adventures of a girl band. The concept behind this series of movies, which revolves around young girls wanting to meet big time producers and make it big in the entertainment industry, barely hides the mind control associated with pop culture. The fact that the movies were produced by Disney, the ultimate recruiter of young talent who turn into sex objects around the age of 16, and the associations with Monarch mind control and sex kitten programming are all too real in Cheetah Girls. What do I mean by “recruiter of young talent who turn into sex objects”? Here’s a handy visual that describes the typical path those young Disney girls go through to stay successful.

As we have seen in previous articles, Monarch programming uses trauma-based mind control to create alter personas in the victims, which then accomplish specific tasks. Beta programming, also known as sex-kitten programming, is used on young girls in the entertainment industry and is coded in popular culture with feline prints on stars (for an in-depth look at feline prints in pop culture, see this post on Pseudo-Occult Media). In Cheetah Girls – as in sex-kitten programming girls – the stars are constantly wearing leopard/tiger/feline prints.


Are those “leaked” sexy pictures some sort of forced initiation rite? Belinda was part of a same type of “leaked” images controversy

Can you get more sex-kitten programming symbolism than this?


BETA. Referred to as “sexual” programming. This programming eliminates all learned moral convictions and stimulates the primitive sexual instinct, devoid of inhibitions. “Cat” alters may come out at this level.
- Ron Patton, Project Monarch

In Cheetah Girls 2, Belinda (the subject of this article) competes with the girl band in Spain and, after a series of crazy events, becomes their friend and honorary Cheetah Girl. Grrreat! So, Belinda truly went through the ultimate school of MK entertainment slaves, Disney.

Mujer Asesina


The symbol of the series is a Butterfly, symbolic of Monarch programming
After playing a role in a Beta programming (aka sex-kitten extravaganza) Disney movie, Belinda appears in the third season of the Mexican novela, Mujeres Asesinas (Killer Women), which is, in turn, a Delta programming extravaganza – also known as “killer programming”.

DELTA. This is known as “killer” programming, originally developed for training special agents or elite soldiers (i.e. Delta Force, First Earth Battalion, Mossad, etc.) in covert operations. Optimal adrenal output and controlled aggression is evident. Subjects are devoid of fear; very systematic in carrying out their assignment.
- Ron Patton, Project Monarch

As the title states, the series is about women who kill for numerous reasons and their resulting police investigation. The series’ promotional material is full of Monarch mind control symbolism.


Shattered mirror is a classic reference to mind control as it symbolizes the compartimenlisation of the consciousness after trauma

Doll with dead eyes, another classic symbol representing mind control
The Inevitable One Eye Symbol

One eye = All Seeing Eye = Illuminati. If you don’t know what I’m talking about, read some previous articles on this site. This sign is the unmistakable symbol of an Illuminati artist. And Belinda does it …

And does it …

and does it.



More Occult Pics

Masonic checkerboard pattern in 3D

This image has some deep occult symbols that regular readers might recognize.
Egoista

After going through Belinda’s impressive Illuminati mind control curriculum vitae, will the fact that her latest video, Egoista, is full of occult symbolism come as a surprise? Here’s the video:



If you read other articles on this site, you might be flabbergasted by the similarities between this video and other pop videos appearing all over the world. Egoista seems to be an attempt to cram the most Illuminati symbols in a 3:30 video. Latins have to be exposed to this crap too, right?


Pillars, checkerboard floors, Baphomet everything is there.
The video starts with Belinda sitting in an Illuminati/Masonic/Alice in Wonderland setting. The “princess” (mind-control victims are sometimes called that by their handlers) is enthroned between two “heart” pillars. The concept of the twin pillars is a Masonic symbol discussed many times on this site. The floor is a ritualistic Masonic checkerboard pattern that is not-so-coincidentally found in Alice in Wonderland. In arcane symbolism, checkerboard floors are the surface on which occult transformations happen, which is why they are found in Alice in Wonderland. Speaking of which, the links between Alice in Wonderland and Monarch programming are many and profound, as the movie’s storyline is used as a programming tool by mind control handlers and many symbols in the movie act as triggers on mind controlled-slaves.

“In the 1940’s and 1950’s, the Illuminati began using Disney’s Alice In Wonderland and the Wizard of Oz films as programming bases for their total mind-controlled slaves. Alice in Wonderland had been done many years earlier by the Britisher William Cameron Menzies (who also did Freemason H.G. Wells’ Masonic forecast of the New World Order entitled “Things to Come” in 1936, and the film Invaders From Mars.).
- Fritz Springmeier, Deeper Insights into the Illuminati Formula

To complete this Illuminati overload, a Baphomet-type head is strategically placed atop Belinda’s throne from hell.

All of those clues tell the viewers that Belinda is in an alternate, fantasy world, the wonderland of Alice In Wonderland and the dissociative dream-world mind control victims escape to during trauma. In other words, this whole scene represents Belinda being under Illuminati mind control.


Pitbull in the “real world”, a distant and painful place for the mind control victim
Meanwhile, Pitbull raps from the “real world”, a dried up and not so inviting place (in the mind of the victim).

In another scene, Belinda is shown dancing/battling with a diamond-studded skull connected to wires, another blatant reference to mind control. I mean, the brain is directly connected to electrical wires.


Skull connected to wires
At the end of the video, Belinda is shown attempting to escape from her mind control state by jumping towards Pitbull and the “real world”. The bee-hive background probably represents the concept of “hive mind”. The attempt fails, however, as Belinda apparently liquefies.


Belinda attempting to go back to the “real world”
Egoista Performance at Premios Juventud 2010

Belinda’s Performance at the Premios Juventud (a Latin awards show specifically aimed at young people) truly drives the concept of mind control home. Mechanical body parts are all over the place: sleeping pods, lifeless mannequins … all of the symbols usually associated with mind control are present.



Belinda starts the performance laying lifelessly on some sort of mind control programming device.



She then gets up in a mechanical, robotic matter and starts performing, with a bunch of half-human/half-robots dancing around her. The whole theme of transhumanism is a must for Illuminati artists.





In Conclusion

Spanish is the third most-spoken language in the world (after Mandarin and English) which means this market is most certainly not exempt from Illuminati influence. Belinda’s career bears all of the telling clues of what I call an “Illuminati artist”, entertainers who often follow these steps: recruited at a young age by media corporation, marketed with a “clean” and innocent image, attracts young fans, goes through sexualization metamorphosis, releases new album with racy imagery, then exposes fans to Illuminati and mind-control themes. Although it is impossible to prove, those types of artists are, in my opinion, those who are the most likely to have gone through actual Monarch programming. Are they aware of what is happening to them and of the meaning of their performances? Probably not. Video directors, stylists, choreographs, scenic designers, music producers and label executives all have a say in these artist’s products and they, in turn, all take orders from higher-ups. “Artists” such as Belinda and her fellow pops stars–Lady Gaga, Beyonce, etc–are nothing more than performers and, if their input is sometimes integrated in the act, it is because they understand and conform to what is acceptable in the pop industry.





Sponsored From Around the Web:
How Penny Stocks Create Millionaires Every Day
How Penny Stocks Create Millionaires Every Day
A New Solution That Stops Snoring and Lets You Sleep
A New Solution That Stops Snoring and Lets You Sleep
How Cruise Ships Fill Their Unsold Cabins
How Cruise Ships Fill Their Unsold Cabins
Economist Caution: Prepare For "Massive Wealth Destruction"
Economist Caution: Prepare For "Massive Wealth Destruction"
How to Exercise Your Brain to Make It Strong
How to Exercise Your Brain to Make It Strong

?
Related Articles:
New Lexus Ad Campaign Filled With Illuminati Symbolism
New Lexus Ad Campaign Filled With Illuminati Symbolism
Bratz Dolls in Illuminati Masquerade Ball
Bratz Dolls in Illuminati Masquerade Ball
Doda and Vintage: Bringing the Illuminati Agenda to Eastern Europe Pop
Doda and Vintage: Bringing the Illuminati Agenda to Eastern Europe Pop
Britney Spears, Mind Control and "Hold it Against Me"
Britney Spears, Mind Control and "Hold it Against Me"
Kyary Pamyu Pamyu Still Bringing Illuminati Symbolism to Kids
Kyary Pamyu Pamyu Still Bringing Illuminati Symbolism to Kids
Tags: belinda, mind control, music business

Comments (397)
Sort by: Date Rating Last Activity
+3
Nuthead · 152 weeks ago
First post. :-D

Anyway, this is just real sad. And to think that these Illuminati ******s are spreading around the world at a ridiculous rate, a virus that will not be able to be eliminated.

How you can decide to sell yourself for such bullshit, I just don't understand.

There really are many ******s in this world.
Reply
+2
caribbean_girl · 152 weeks ago
this just makes me sick i cant believe it......great article as usual
Reply
+5
Alexa · 152 weeks ago
i guess that Illuminati's can be cheap too ,her music video looks like a $1 music video . In real life ,Belinda is in a lot of trouble in Mexico , sex scandals ,lesbianism ,etc.

Everyone blames her parents ,who control her and of course her money .
Reply
0
rossy · 152 weeks ago
I can't believe this!! What the hell is going on?
Reply
0
Rene ramot · 152 weeks ago
Just was going to send you an email about this video that bothers me a lot.

The Vigilant.C Thanks!
Reply
0
Rachel · 152 weeks ago
Great Article VC!
Reply
+3
jocelyn · 152 weeks ago
i actually like this song but honestly i dont know how teens do not see a pattern.songs these days dont even go with their performances or with their videos anymore.

thank you vigilant for writing about these things because before i wouldn't pay that much attention to these things but now its like a must lol
Reply
+4
jimmy · 152 weeks ago
so sad, im mexican and i can remember when se acted in this soap opera called Amigos por Siempre (Friends Forever) (pic link below)
http://u.univision.com/contentroot/uol/art/images/tv/nov/fichas/ficha_amigos_3_030503.jpg

and comment no.3, Alexa, is, right, about 3 months ago she was in a sex scandal with the owner of a soccer team (accidentally on puropse??) and now she has a new album and everything

i feel bad, because this is happenning in MY city (mexico city)
Reply
0
Rubén · 152 weeks ago
Please translate as much as you can, i think it's important for people all over the world to open mind and criteria, to be aware not only for mind games and mind control, also for this negative side oft he human being and all what it takes.

Saludos desde México.
Reply
0
Zero · 152 weeks ago
Videos nowadays are getting more and more obvious. jeezz....

anyway, great article VC! :-)
Reply
0
nEEd-O · 152 weeks ago
well, nothing is new, except the new title or a new subject or in other words "new victim"

great article, worth reading

it's like things like this is so usual to know
Reply
+1
Britt · 152 weeks ago
It just gets more and more obvious. I can't believe some people refuse to believe there's anything going on here. They're practically smearing it in our faces.
Reply
0
aaa · 152 weeks ago
Well, you can't compare Belinda to Gaga...
Reply
+2
Rebecca · 152 weeks ago
it's becoming so predictable now, yet people still don't see it. thanks for the article.
Reply
+3
victor · 152 weeks ago
this really drives it home for me. as a mexican, to see this sort of infiltration reach the spanish-speaking world is truly shocking.
Reply
0
Christina M · 152 weeks ago
this is so weirddd.. i don't even like this songg.. lmao
Reply
0
JWSO · 152 weeks ago
It's like they are dry humping each other... Not for my kids! Thanks VC

BTW- any idea what Egoista means in english?
Reply
2 replies · active 7 weeks ago
0
kidPEPE1 · 152 weeks ago
UGH!!is nowhere safe from these tyrants!!!well well well ,do these pop stars not see what they will end up as?!they should open there eyes or stop giving in to the temptation!!!
Reply
+1
caribbean_girl · 152 weeks ago
Atleast we dont have soca artists here in the caribbean doing this crap......bless the good Lord
Reply
0
JWSO · 152 weeks ago
I failed to watch the first video, but after I watched I noticed a couple blatant signs.

The last one was at the end of the vid where she -attempts- if you will to kiss the diamond studded skull.

From what I remember kissing was a sign of a covenant. Obvious sign of a pact.

Thanks again VC.
Reply
+4
chas · 152 weeks ago
OMG this is shocking.I was a fan of the cheetah girls but i didnt recognize the fact that it had some symbolism in it (sex-kitten programming). But these artists nowadays are predictable and Illumanti is really controlling people their mind,soul,and body. Ugh why would they want to sell out for the fame..its not worth it at all. another good article vigilant .
Reply
+3
Megan Bishop · 152 weeks ago
It's insane how widespread this really is!
Reply
0
Dondada · 152 weeks ago
VC - As always, great work.

Until we do something about it, they continue to win.

By the way, what's up with people feeling they need to establish that they were the first posters? I can't figure that out. Must be immature children posting. At least young people are reading these articles too.
Reply
+5
Poly · 152 weeks ago
Hello VC.

I am mexican and a public communication student.

You only missed that Belinda has been working for one of the greatest Television Monopolies in our conountry. She has been making "novelas" since she was a primary school child. What a great way to take advantage of her already huge fanbase to spread hegemonic thought...
Reply
1 reply · active 35 weeks ago
+2
slick7rick · 152 weeks ago
i just think it's so sad that teenage girls look up to these sex puppets.. the world we live in doesn't seem to offer young children any positive role models..
Reply
+1
Marco · 152 weeks ago
More proof that Satan is the god of this world... because his symbolism is everywhere.
Reply
2 replies · active 35 weeks ago
+2
LVB · 152 weeks ago
Hey Vigilant - great work, as always.

Wherever you're getting your ideas for source material, keep doing it, because these last few articles exploring Illuminati/Masonic/MK themes and imagery in the international music markets are especially important for people to realize and understand.

It's not just for Americans/Canadians/Europeans anymore - it is global mass media programming of the (mostly) oblivious and apathetic masses of humanity. The "hive mind" is the goal, and the pace is accelerating rapidly on every level for total control - news and entertainment (PsyWar), financial, political, medical, etc.

Thanks for all you do and take care, man.
Reply
0
27moni · 152 weeks ago
i don't see why anyone is shocked by this. The illuminati are not just limited to the U.S., and may not have even started here. This is global
Reply
+3
Elisha · 152 weeks ago
I think and strongly believe that only GOD has the solution.
Reply
3 replies · active 35 weeks ago
+3
Andie · 152 weeks ago
https://www.youtube.com/watch?v=_3O4VF1EC50
This was her song when she was still a little younger (2006)

Nothing bad in the video (I think)

But listen closely to the lyrics, especially in the start in the end.

(lyrics in the start and end of the song)

Stay alone in my room , every moment passing too slow, watch the candles

burn into the night

Fall into a dream , wake up and everythings the same, a second older, but alone, just

like a child
Reply
0
Sean P · 152 weeks ago
Super post VC. Love your analysis. I've been following your work for a while and, now,

when it comes to recognizing hidden symbols in videos and stuff it seems like second nature.

BTW another Columbian singer Veronica Orozco could be cut from the same

cloth. She was hot for a minute a few years back. Album cover is the first clue. http://spc.fotolog.com/photo/12/29/81/owai/1225067717076_f.jpg
Reply
0
Me · 152 weeks ago
Actually, althought I know it's not entirely accurate, I read on wikipedia that the actual order for the languages was:

1. Mandarin

2. Spanish

THEN

3.English

o.o So of course, as you said, the Spanish aren't left out. But further, for them to get involved makes it even more so a much greater problem!
Reply
3 replies · active 35 weeks ago
0
Lauren · 152 weeks ago
Great article, as per usual...

When will you be covering "Can't Be Tamed" by Miley Cyrus?

I showed it to my boyfriend, and before we were ten seconds in, he said "Holy shit".

Something to think about!
Reply
1 reply · active 35 weeks ago
0
Tulips from SA · 152 weeks ago
Hey VC - great work as always...

When will you be covering the mother of occult - Madonna, also Marilyn Manson.

BTW - have you noticed in the MTV adverts - all the major symbols been showed - like flashed on screen..... check it out?

Also check out a book by Lew White called Fossilised Customs - there are several editions of this book. Covers a lot of symbolism, pagan days (christmas is NOT a holy day for real believers) etc etc.... check it out!

Surely they've been in the music industry for ages and you should be pulling them apart by now, looking forward to more articles. Keep up the good work!
Reply
+3
The Knight · 152 weeks ago
Strange but you know now after this article I remember that Belinds was mentally unstable for a while if not in a mental institution she disappeared bc her boyfriend was passing a semi nude pciture all over the internet and this made her to have a nervous breakdown...according to the media so she was gone for a while remember guys?

People need to not support this evil immorality anymore! Do not watch, buy, listen...stop and they will loose money and teach those around you why we should not support them!
Reply
+5
concerned mom · 152 weeks ago
ITA that Miley Cyrus's "Can't Be Tamed" is significant. When she is on that goat platform, dancing around with the other dancers. It reminded me of the scene from the film "The Ten Commandments" with Charlton Heston, when the children of Israel had made a golden calf and put a girl on it to sacrifice.

IMO, all of these women acting this way is pointing us towards the unveiling of the church of Satan, at some future time. And IMO, what will happen is human sacrifice. I wouldn't be surprised if Lady Gaga was the first to go. She has publicly stated she is sexually abstinent right now. And she has acted out her own sacrifice to Lucifer, at the MTV awards. Wouldn't be a huge leap if it happened.

When you look at the images from that movie from the early 1900s, Metropolis, and the movie with Christina Ricci called After.Life (which movie deserves an analysis, IMO)...and compare it to imagery from these music videos...singers bleeding, wearing white and then enacting some kind of ritual and then being dressed in red....

IT ALL POINTS TO HUMAN SACRIFICE, as a ritual to Lucifer, IMO. That is what is coming. The Illuminati are preparing the teens of today to accept this kind of occult ritual so that when it is unveiled openly, they won't be shocked, and will go along with it. Possibly help force it on everyone of other ages. It is the opposite of the true gospel, the voluntary sacrifice of God's Son, to atone for our sins. Satan always does the opposite....he will force the killing of women as a show of devotion to him.

I really hope I'm wrong, but it really appears to go that way. A boutique that carries jewelry for teens recently began carrying necklace pendants that are daggers or something like that, that points to suicide as if it's cool. Then there's Rihanna's video with Eminem, about her being burned and liking the pain.....it all fits together. Sacrifice of women. It makes me ILL.
Reply
2 replies · active 7 weeks ago
+1
RIchard · 152 weeks ago
Welcome to the real world..
Reply
+1
joseph · 152 weeks ago
hahah those illuminati bastards are getting sloppy - more and more hidden occult had been discovered through out the globe. keep up the good job VC!
Reply
1 reply · active 35 weeks ago
0
oanatienko · 152 weeks ago
"Let go, let go, let go - my Eggo"...Lmao - this is one manly looking puppet!
Reply
+1
Zukayi · 152 weeks ago
Thanks for the great articles VC! It clearly shows that the whole inhabited earth is in the control of Satan!
Reply
0
Oohgway · 152 weeks ago
Hi VC,

Great article !

Genuine question - could you please tell me why the Illuminati are making the 'hidden' symbols and references alot more obvious?

You'd think that they'd want to remain under a cloak of darkness for as long as possible, no?

Thanks so much in advance
Reply
2 replies · active 35 weeks ago
0
cantfathom · 152 weeks ago
I think these so-called illuminated ones (AKA, : Luciferian Bastards!) are gearing up to do something big in 2012 - going to take their own sick on twist on the Mayan Calendar

Everyone above is right - the signs are becoming more and more blatant - something's about to give - I just hope it's not humanity and the goodness of life :-(
Reply
0
0583257 · 152 weeks ago
This isn't funny at all. Especially if you realize what it is leading to... we are close to the end.
Reply
1 reply · active 35 weeks ago
+2
Rainbow snake · 152 weeks ago
Simple solution. Boycott Illuminati influenced music! If we don't support them, they cannot survive.

BTW, go to www. + spell illuminati backward + .com, and see which website you go...
Reply
4 replies · active 26 weeks ago
0
SEC · 152 weeks ago
Nuthead says:

September 7, 2010 at 9:43 pm

First post. :-D

Anyway, this is just real sad. And to think that these Illuminati ******s are spreading around the world at a ridiculous rate, a virus that will not be able to be eliminated.

How you can decide to sell yourself for such bullshit, I just don’t understand.

There really are many ******s in this world.

Im sorry but your the genuine "******'' here, those Illuminati ''******s'' as you call them are alot smarter then you are , mr. Nuthead. And please stop mentioning that you post first, its ridiculous.
Reply
+1
Ccchick · 152 weeks ago
Great on the article............... but my news is something I for one never expected.... I found a MASONIC LODGE In SOUTH AFRICA on Saterday and it had like the compass symbol and everything very unexpected in was located in on of the South African heritage site villages the Pelgrims Rus to be exact I am so lucky I got the chace to even take a photo of the place............ JUST GOES TO SHOW THE MASONS AND ILLUMINATI IS TRUELY EVERYWHERE....
Reply
2 replies · active 35 weeks ago
0
skopp888 · 152 weeks ago
I made a drawing on that picture with the deep occult symbols here: https://docs.google.com/drawings/edit?id=1bLYQ6VJQaKTL0f2V1V0Dlt1OsBwmE-bDejb3WVsdQnQ&hl=en_GB&authkey=CMaq5Ac

I put some stuff in thewre that I noticed. Check if you see anything else.

Feel free to add-on stuff, make it prettier etc. Have fun!
Reply
0
Cariemah · 152 weeks ago
Really2 great article...

All this time i never realize it, thx to explained for us.

U rock..
Reply
0
Misa · 152 weeks ago
OMG!!! i knew this video had something!! scince the time it got on mtv! ah... belinda is having really serious problems in her life... maybe are related with the illuminati? and by the way she directed this video!
Reply
0
Cperfringens · 152 weeks ago
Great article as usual. Can you do some more Sinister Sites, I really like that series.
Reply
1234567Next »
Post a new comment

Name Email

Displayed next to your comments.


Not displayed publicly.

Submit Comment








STAY VIGILANT

Visit Us On FacebookVisit Us On TwitterCheck Our Feed
E-MAIL NOTIFICATIONS

Get notified when new articles are published







MORE IN HIDDEN KNOWLEDGE

The Mysterious Connection Between Sirius and Human History
The Order of the Illuminati: Its Origins, Its Methods and Its Influence on the World Events
Origins and Techniques of Monarch Mind Control
Aleister Crowley: His Story, His Elite Ties and His Legacy
Who is Baphomet?

TAG CLOUD


Top Posts

Gigantic Pentagram Found in Kazakhstan - Can Be Seen in Google Maps
Paris Jackson Enters Treatment Facility + Her "Illuminati" Tweets
The Hidden (And Not So Hidden) Messages in Stanley Kubrick's "Eyes Wide Shut" (pt. II)
Sinister Sites - Astana, Khazakhstan
UK is About to Filter Out Internet Adult Sites and..."Esoteric Material"?
Browse

Latest News
Music Business
Movies and TV
Vigilant Reports
Sinister Sites
Pics of the Month
Viral Videos
Hidden Knowledge
Stay Vigilant

Visit Us On FacebookVisit Us On TwitterCheck Our Feed
More VC

About VC
Educate Yourself
Contact VC
E-Mail Signup
Download the VC E-Book
Advertising Inquiries
2013 The Vigilant Citizen | Privacy Policy | Advertising Inquiries

LEONA LEWIS = illuminati ????


Pseudo-Occult Media
HomeContact POMDisclaimerDynamicSupport POM

Saturday, 23 August 2008

Leona Lewis: Keep bleeding...
[slightly updated and bumped to 23rd because of recent news, originally posted on May 1st I think]

6 pointed stars (hexagram/hexagon), Black/white symbolism, there is a crescent moon behind her head, half her face is covered(ish) by her hair.

Any singer who has an unbelievably quick rise to stardom and is constantly built up by the media tells me there's something behind it (talent rarely has anything to do with it). Leona Lewis resonates the divine because her name has two backwards El's in it. El is one of the names for God in Judaism, so to have two in her name is quite symbolic, maybe even for twin pillars, twins in general. Leona's biggest hit has been her song "Bleeding in Love" (biggest selling single of 2007), could this be a blatant subconscious (or conscious, who knows) synch of her being a blood sacrifice (like Amy Winehouse, Britney Spears, other people the media constantly obsess over)? The chorus of 'Bleeding Love' goes, "You cut me open and I... Keep Bleeding... Keep..Keep Bleeding in love." Nice. I actually like the song a lot though. It sold 66,000 copies on it's first day. She performed the song on American Idol on 23rd April in it's seventh season. In America, the single went to #1 after six weeks.


Edit: Added some additional images + see this video of her being interviewed at the 46664 concert and note the Zain (or oz [the a is oddly stylized] when considering the hurricane/spiral logo with it, also the Investec [uses Zebra in it's advertising, pulled this one from the 46664 period with the ironic "liberated thinking"] target/stargate/solar cross symbol; synchgasmic) and the numbers obviously. She is 23 and is performing in the Closing Ceremony of the 2008 Olympic games with occultist Jimmy Page, checkout NewSpaceMan's coverage. And how's this for a new (mind controlled) X-Factor contestants, had her first child at 13 [link here, typical traumatic life of an MK victim].


Best I could do in terms of LL pictured with Freemasonic checkerboards... [Edit: Her video Better in Time has her blatantly strewn across the Freemasonic checkerboard, can't believe I didn't put this in sooner.]



Another thing is she resonates Oz too as she sung "Somewhere Over the Rainbow" (how much is that song used ritualistically?!?! didn't a young Israeli girl sing it to Bush recently?) in one of her X-Factor rounds. This is shown in the video below, where Sharon Osbourne (Oz) judges her, adding to the whole Oz thing. Universal hate-figure/emotion-sucker Simon Cowell calls her Oz song "The single best performance I have ever witnessed", showing even more it's significance and how Simon Cowell builds her up so much. The video also obviously has lots of X symbolism, Luciferian light and whatnot. She is "mentored" and managed by Simon Cowell, pictured above with his gold and blue freemasonic Jet-ski. Also from Wikipedia: "On the Oprah Winfrey Show on 17 March 2008, Simon Cowell said that it was during Lewis' barefoot performance of "Summertime" in the third live round of The X Factor (broadcast 28 October 2006) that he "could see her transform from a great singer into a superstar" Summertime resonating the Sun, in the third round. Her transforming from a great singer into a superstar is symbolic of butterfly's transformation so you can bring in Monarch mind control here (the picture to the left of Simon Cowell making Xs with his arms and red/white X factor X behind, could well be hinting at this with a square on the butterfly wing too; Edit: Found this image where she appears to have a butterfly belly button jewelry thing).




Like Cristiano Ronaldo (they both have resonant names too), Leona Lewis is 23. Her debut album is called SPIRIT. If you look carefully at the album cover, her eyes have a greenish glow. Also if you look carefully you can see that (just about) half her face is in slight shadow, the other in light. Whenever a W is written like it is on the album cover (a W made to look like 3 V's, volkswagen logo, weinstein movie company etc.) I automatically think of 666 because in Hebrew V is 6 so that could also be significant. The album is the first British debut album to go straight to number 1 in the US. Wikipedia states that "With her album reaching number one in at least three continents and nine countries, Lewis has had the most successful launch of any television talent show winner ever."[emphasis added]

Corporate contracts, I believe are part of the massive ritual going on on Earth. This is shown in my previous posts on football which contracts were mentioned a lot. In America she signed a 9.7 million dollar contract with J records. She worked with many different song writers, one of them is called Stargate who himself worked for S Club 7 (remember them? how amazing were they!!!), and goddess resonators like Rihanna and Beyonce.
Check out her wikipedia page for more synchs.

To finish off, a quick but powerful synch: Below is two pictures taken from Murdoch's Sunday Times Rich List. In the Young People's Rich List she is number 77. Simon Cowell, in the main Rich List is number 717.




Everything in this article is entirely speculative, do not take it too seriously. I mean no offence to any Leona Lewis fans or anyone.
You might also like:
Terry Richardson: Illuminati FTW
New Disney Alice in Wonderland Trailer
Fashion’s Illuminati It Girls: Cara Delevingne
Milla Jovovich: How To Get Ahead In Illuminati Hollywood
LinkWithin
Posted by Benjamin Singleton at 09:01
Email This
BlogThis!
Share to Twitter
Share to Facebook

Labels: 17, 7, 77, conspiracy, El, goddess, Hebrew, illuminati, Leona Lewis
8 comments:
aferrismoon said...
Fine post - I just put a post up with a 'cow' in it, linking with COW-EL , the Cow God .
+ in the same post a pic from FAMILY GUY showing the Wizard of OZ characters.
Also there's LEO in her name, while NEWSPACEMAN posted a blog a couple or so weeks ago, about the Masonic instrument THE LEWIS
Anagram = LL A WISE ONE
while Leona gives ENOLA and ALONE
ALONE L - WISE [ with the L representing the Mason Square]
Cheers All Wise One
1 May 2008 06:37
Benjamin Singleton said...
Yeah good info, cheers.

I thought of the Leo the Lion one later that night, it's my astrological sign though so you'd think I'd have noticed!

I covered that Simpsons episode too (see my post Holy Synchromystic Sundays on FOX), which had some interesting imagery + zooey.

But not in the same way you did it, I just uploaded the caps, great post btw.
1 May 2008 06:53
Benjamin Singleton said...
Also, I'm probably going to run into some copyright problems with all the scans/screen caps I put in, does anyone have any tips for avoiding such issues? Cheers.
1 May 2008 06:55
aferrismoon said...
Cheers for leading me to your post , its great - quite the same, and little bits difference.
Both have the same Golden Dawn shot
I thought about the WEDDING scene but just went another way - can't put it all in, sometimes Simpsons = a constant stream of synchro-stuff.
Check Tod's latest article at THROUGH THE LOOKING GLASS , he has a photo of a pile of pigs, I told him about the piles of cows in Simpsons
NEWSPACEMAN includes the LEWIS in his latest post with a link to the original article - so that synchs up nicely
Re: copyright - don't know
1 May 2008 08:07
Benjamin Singleton said...
HAHA that's quite funny that you mention that post, so synched. Check out my post (Don't let the pigs get away) where I linked to the article you speak of. I was thinking of putting that pile of pigs photo in it, if I'd have made the connection you have I definitely would have added it (they're so obvious once someone points them out to you, ty).
1 May 2008 09:03
Anonymous said...
Seriously?
19 October 2009 12:25
Anonymous said...
please stop quoting wiki for every numerology combination you had in mind... it makes your efforts seem pathetic, and that's not the case.
by the way... you should really check the movie 23 ... can you see it?
4 February 2011 04:36
Newspaceman said...
Leona - Lioness

Lewis - a "lewis" stone is utilised in masonry to move a heavier stone into place. Think about that on a larger scale, in terms of collective/group mind control.

http://www.freemasons-freemasonry.com/falclewis.html

cheers
20 January 2013 10:50
Post a Comment

Newer Post Older Post Home
Subscribe to: Post Comments (Atom)
Related Posts with Thumbnails

Blog Archive

► 2013 (7)
► 2010 (16)
► 2009 (150)
▼ 2008 (357)
► December (25)
► November (37)
► October (42)
► September (62)
▼ August (38)
IlluMiMusiC: 'Kat'y Perry
Closing Ceremony Ritual Images
Father stabbed to death on his doorstep by a menta...
IlluMiMusiC 1
Kate Moss Egyptian KM|MK Goddess
"Generate Power"
More Mind Control Ritual Slaughter
Orangina advert 'too sexy'
The World's Gone Postal, by Design
Mind Controlled 15 Year Old Suicide Bomber in Iraq...
Madonna in the Land of the Dragon
Vlad the Impaler: MiddleMan and Puppet for The Ord...
Leona Lewis: Keep bleeding...
2008 Olympic Ritual Capped by Occultist Jimmy Page...
'Organised chaos' at crash airline Spanair
'Failsafe' face scanners could replace passport of...
KiLLING FOR M-I-C-K-E-Y M-O-U-S-E
Mind Control X-File #2
Salvador Dalice in Wonderland and Others Pushed Do...
Osama in the Land of the Gods with Isaac Hayes and...
Verdier on The Kennedy Assassinations and Russian ...
They've Messed With The Zohan's Head
The Great Satan
BBC's 2012 Predictive Programming on orders from M...
CHAOZ
Heath Ledger's Two Hands
Sirhan Sirhan: The First (Mind Controlled) "Palest...
Chinese man stabs to death relative of US Olympic ...
'Sexiest Woman' Megan Fox to play Mother Teresa
Is tomorrow, 8/08/08, the luckiest day of the year...
Britney's Freemasonic Homeland and The Rainbow Gir...
Twin Serpent Freemasonic Banking Wars in LA
I've Got Soul but I'm Not a Soldier
More MCM Occultism and Rowling's Fairy Tales
Presidential Candidates Planning Wars with other N...
2001 Anthrax Terror Attack Patsy "Suicided"
MKnifeman decapitation on Greyhound #1170 bus
7/7's 52 Pillars Memorial
► July (45)
► June (33)
► May (58)
► April (17)
Contact POM

pseudoccultmedia@gmail.com
Popular Posts


Purple Star Cyrus
To get me back into the swing of posting (started this before posting the previous 2) I'll continue my 2009 MC coverage (all images ar...

Natalie Portman Kabbalistic Kitten
After seeing this photo shoot by Ellen Von Unwerth I decided to put together a post on Natalie Portman (a while back now, I wanted to get...

Karen Mulder: Depersonalized Monarch Doll
Most readers who are into this stuff will be aware of Karen Mulder 's story, it has been covered on some forums and gone into briefly a...

Disney's Programmed Princesses Selena and Demi
I saw Disney's 'Princess Protection Program' was airing later on in the day when randomly flicking to Disney Channel so dec...

The Art of Dissociation
The paintings featured in this post are by an artist with MPD/DID going by the name of Kim Noble , who began painting after time with an art...

Megan's Mannequin
Quickly cobbled this one together because I'm being so damn slow with other posts with more writing in them (this kind of post s...

Shakira: Freedom is a Lie
Apologiez for the long delay in posting this, I was reluctant to do much work on it for some reason (it's messy and could have obviously...

Laetitia Casta's Pure Genus of Butterfly
I wanted to post this Laetitia Casta advert with her mirrored by a diamond shaped (giving the mirror triangular fragment/fragmented mind ef...

Rihanna the Imprisoned ManneKitten
Without coming across like a broken record; their videos are getting increasingly more blatant and predictable (like GaGa 's most r...

Irina in the Sheikh's Model Harem
Another random model, which err.. obviously has nothing to do with her Luciferian levels of hotness ... Irina Sheik (Shayk/Shaykhlislamo...
Support POM

If you have enjoyed reading or feel that POM has helped you in some way and are feeling generous, all donations will be gratefully received.


AANGIRFAN
AFERRISMOON
Atlantean Times
Cathy O'Brien: Trance-Formation
CCRG
Celtic Rebel
Cremation of Care
D7 - VY Canis Majoris
David Icke Forum MK/Kurt Cobain Thread
David Icke Forum Stepford Wives/MK thread
dedroidify
Elluminati
Etemenanki
Illuminati Formula for Mind Control Slaves
In 2 Worlds, MK Movie Symbolism
In2Worlds
Know Dissociation
Lenon Honor Films
Live from the Logosphere
LVB Research
Matthew Delooze Blog
Michael Tsarion forum
MK Culture
Multiple Marissa
NewSpaceMan
No One Has To Die Tomorrow
Occult Media Deception
Red Ice Creations
The Atlantean Conspiracy
The Freeman Perspective
The Secret Sun
The Stygian Port
Through the Looking Glass
Vector Equilibrium
Vigilant Citizen




[X]

Simple template. Powered by Blogger.

The Illuminati is real, and it's everywhere.

Amy Winehouse Joins the Notorious 27 Club
image
The 27 year old singer was found dead at her home today. The reason for death has not been confirmed yet, but “drug overdose” is the suspected cause. Though how she died might be still a question, we have a clue who exactly was responsible. Joining more than 34 artists in the “27 club”, she was a sacrifice.
Winehouse was quoted saying, “I have a feeling I’m gonna die young”, in 2008 to her former personal assistant, Alex Haines who’s exact quote was: “She reckoned she would join the 27 Club of rock stars who died at that age. She told me, ”I have a feeling I”m gonna die young.’” December 2008, also the exact year of her Blood Sacrifice art sculpture of her shown dead and shot with blood out of her brains *Monarch Mind Control and a Minnie mouse mask *Mickey Mouse Programming, November 2008. Her sacrifice was planned out 3 years later, and she died 3 days after her last performance. Many artists do a photoshoot or movie that depicts their own death and in that exact way they are dead. In her case, a blood sacrifice art sculpture left her in a blood sacrifice for the 27 Club. She predicted her own death after the photoshoot which is typical: Brittany Murphy, Kurt Cobain, Tupac, Heath Ledger, and many more all knew they were going to die. However she was heavily under mind control and programming at the time of her death. 'Amy said she always knew she'd join the 27 club': The truth about Winehouse's death wish
Amy Winehouse was programmed since birth or rather born into ritual/typical Mk-Ultra abuse. Rehab is another word or code for reprogramming, so yes she was in her programmed alter/state of mind (dissociation) when she died. Found ‘dead’ on 7/23/11, age 27 and 311 days. Obviously masonic 311 stands for 3 x 11 or 33 (degree). Since she is a member of the 27 Club, the amount of days after they turned 27 is important and counted. So exactly on the 311th day after tuning 27 she is dead. The whole date together (7+2+3+1+1) is 14 and 27 (2 x 7) is 14. 7x2=14 3x11=33 or 7x2=14 3+11=14 so 14/14 from the date: (7/2)(3/11) 7/23/11 . Now using the total 14: 14-11 is 3 and 14-3=11. 2011 (2+0+1+1) is 13. (2+3+1+1)=7 or 7/7. 14/14. Double digits or the same number repeated 77 gives power to the ritual. Add the numbers (7+2+3+11), you get 23 altogether. Add (7+2+3+2+0+11), you get 25 or 7. Artists are known to die on the date 25/age 25 or age 27. This is because 25 in the occult stands for 7 while 27 stands for 9. 7, 9, 11, 13, 23, 25, and 33 are occult numbers which are all used in the date. Her tattoos consists of a bluebird, ruby shoes, lightning. The number 27 is a lunar symbol, for light in darkness or light itself. 27 Club consists of other artists specifically rock who also had problems with drugs, addiction, and substance abuse which led them to death or a ritual sacrifice. Note this. At age 27, there’s the highest brain activity, and then it starts to deteriorate slowly. That’s why it’s called the “Forever 27 Club” or 27 curse. It is linked with Mk-Ultra- living “forever young”. She was a blood sacrifice to Kelly Osbourne (most likely) other conclusions her godchild or her father. R.I.P For more on Amy Winehouse: click here Her body was taken out of her home in a complete, red body bag. Red is the color of ultimate blood sacrifice and a ritual. Time of death: Amy Winehouse was found in her apartment at 4:05 P.M. 4+5=9. She died 27 years 2+7=9.
Amy Winehouse’s neighbor heard screaming, howling, and drums beating: sounds exactly like a ritual killing around 2 A.M.
image
Red body blag, blood sacrifice ritual.
Found dead 4:05 P.M (9)
Died 27. (9) 27 Club.
Screaming, howling, drums beating early morning by her neighbor which he said was completely unlike her, he is certain she died Friday.
Carried out in complete red.
Died 27 years old and 311 days (33)
Blood sacrifice art sculpture with blood and a minnie mouse mask 3 years before her death.
Died 3 days after last concert.
Told her manager she was going to die early.
7/23/11 (Contains all numerology in date)
Unknown cause of death, autopsy fails, inconclusive. (lethal injection) 100% not caused by overdose or drugs for autopsy failed.
So she was killed on Friday in a ritual, then her dead body found in her apartment on the exact numerology planned date. If she died Friday, which I believe she did just as her neighbor confirmed noises. she would have died 7/22/11 22+11=33 the same day as the Olso bombing, still masonic either way 311 days 3x11=33. They couldn’t have the death on the exact same day, it’d cause suspicion. So Amy’s death was announced the next day.
Drums beating, screaming and howling heard near 3 AM by neighbors, all part of the ritual.
Edit: At the 2011 MTV Video Music Awards, MTV dedicated a tribute to Amy Winehouse, celebrating her life and mourning her death. They did the same for Michael Jackson 2009 (11). 9+11. 8/28/11 (8+2+8=18, 18=9) 9/11.
image
Different alters;ribbon, pyramid.
image
All seeing eye and red background, again referencing to a blood sacrifice.
image
An art sculpture of Amy Winehouse lying dead in a pool of blood, predicting her future outcome blood sacrifice.
Posted 2 years ago 309 notes • 23 Comments
Tagged: 27 club, all seeing eye, amy winehouse, illuminati, blood sacrifice. Source: mediaexposed
owenio likes this
hipthrustingpanda reblogged this from mediaexposed
the-lighted-being reblogged this from mediaexposed
ellengoesrawr7 likes this
myhandmadejewelry likes this
wtdwytkatwyli reblogged this from mediaexposed
ticklemebottle likes this
sailorjade likes this
saffron--extract reblogged this from mediaexposed
tizzithefantazmic likes this
arsendestroyz likes this
julina-rice reblogged this from mediaexposed
vreemdgaanherkennen reblogged this from mediaexposed
good-win-resto reblogged this from mediaexposed
rastafarigirl reblogged this from mediaexposed
beauty-and-lifestyle reblogged this from mediaexposed
lebaneselovatic reblogged this from mediaexposed
miami-blogger reblogged this from mediaexposed
mummies-for-kids reblogged this from mediaexposed
fotomem reblogged this from mediaexposed
kristengomez likes this
utica-dwi-lawyer reblogged this from mediaexposed
donewithhumans reblogged this from mediaexposed
spaulding182 reblogged this from mediaexposed
wheressallie likes this
iseesigils likes this
me-tina-are-mad-pooper likes this
pullupinyourfastcar reblogged this from mediaexposed
jbriggaaaaa reblogged this from mediaexposed and added:
dang… I believe it.
treatment-depression likes this
treatment-depression reblogged this from mediaexposed
msgrandpre reblogged this from mediaexposed
ugliestgala89 likes this
loudpachino reblogged this from mediaexposed
joycekawehelani likes this
cequla reblogged this from mediaexposed and added:
Wow. First Illuminati & now this… WTHECK.
wearyoursoul likes this
cupcake-wedding-cakes likes this
birthing-ball likes this
segajenesisss likes this
abittersweetdesire reblogged this from mediaexposed
sofuckyourulesman reblogged this from mediaexposed
percivalwulfricbryan likes this
sleepingwithlions likes this
mediaexposed posted this

Blog comments powered by Disqus

"Signs and symbols rule the world, not words nor laws." -Confucius





AskSubmit
FAQ

My blog All of Tumblr
Follow on Tumblr
RSS FeedRandom
ArchiveMobile
© 2010–2013 Media Exposed


Read more: http://mediaexposed.tumblr.com/post/7984782005/amy-winehouse-joins-the-notorious-27-club#ixzz2bhiUVl00

AUGUST 10TH 2010

Why did the Illuminati kill Amy Winehouse?
What was she about to expose?

The Illuminati conspiracy is a conspiracy theory which holds that there is a "global elite" society that is either in control of the world, or is seeking to take control of the world. As with most conspiracy theories, beliefs regarding the Illuminati conspiracy vary widely. As a result, it is virtually impossible to give a synopsis of the Illuminati conspiracy. Popularized in recent books and movies, the Illuminati conspiracy has definitely reached "cult fiction" status.

If there is indeed some truth to the Illuminati conspiracy, the Illuminati are nothing but pawns in the hands of Satan, tools to be manipulated in his conflict with God. The fate of the Illuminati will be the same as the fate of their lord, Satan/Lucifer, who will be cast into the lake of fire, to be tormented day and night, forever and ever (Revelation 20:10). In John 16:33 Jesus declared, "In this world you will have trouble. But take heart! I have overcome the world." For Christians, all we need to understand about the Illuminati conspiracy is summarized in the words of 1 John 4:4, "You, dear children, are from God and have overcome them, because the One who is in you is greater than the one who is in the world."

http://www.gotquestions.org/illuminati-c…

The Illuminati
By: Larry Burkett
http://www.christianbook.com/the-illumin…

What is the New World Order?

http://www.gotquestions.org/new-world-or…

You NEED To See This
https://www.youtube.com/watch?v=qNZvfiKrJ…
2 years ago Report Abuse
33% 5 Votes
17 people rated this as good
9stars - mark this as Interesting!
Email
Comment (1)
Save
Other Answers (24)
Bridgee
Bridgee
I found this about her and her involvement with the Illuminati and the Forever Young 27 Club:


Winehouse was quoted saying, “I have a feeling I’m gonna die young”, in 2008 to her former personal assistant, Alex Haines. “Forever Young 27 Club” 2008 is also the exact year of her Blood Sacrifice Photoshoot of her shown dead and shot with blood out of her brains *Monarch Mind Control and a Minnie mouse mask *Mickey Mouse Programming. Her sacrifice was planned out 3 years later, and she died 3 days after last performance. Many artists do a photoshoot or movie that depicts their own death and in that exact way they are dead. In her case, a blood sacrifice art sculpture left her in a blood sacrifice or solstice for the 27 Club. She predicted her own death after the photoshoot which is typical: Brittany Murphy, Tupac, Heath Ledger, and many more all knew they were going to die. However she was heavily under mind control and programming at the time of her death.
Amy Winehouse was programmed since birth or rather born into ritual/typical Mk-Ultra abuse, and Kelly Osbourne tweeted that who is also a Mk-Ultra slave whom her dad has the key to her alters. Rehab is another word or code for reprogramming, so yes she was in her programmed alter/state of mind (dissociation) when she died. Found ‘dead’ on 7/23/11, age 27 and 311 days. Obviously masonic 311 stands for 3 x 11 or 33 (degree). Since she is a member of the 27 Club, the amount of days after they turned 27 is important and counted. So exactly on the 311th day after tuning 27 she is dead. Interesting how the whole date together (7+2+3+1+1) is 14 and 27 (2 x 7) is 14. 7x2=14 3x11=33 or 7x2=14 3+11=14 so 14/14 from the date: (7/2)(3/11) 7/23/11 . Now using the total 14: 14-11 is 3 and 14-3=11. See the pattern? 2011 (2+0+1+1) is 13. Numerology works with a number/number, so (2+3+1+1)=7 or 7/7. 14/14 was used too. Double digits or the same number repeated 77 gives power to the ritual. Add the numbers (7+2+3+11), you get 23 altogether. Add (7+2+3+2+0+11), you get 25 or 7. Artists are known to die on the date 25/age 25 or age 27. This is because 25 in the occult stands for 7 while 27 stands for 9. 7, 9, 11, 13, 23, 25, and 33 are occult numbers which are all used in the date. Her tattoos consists of a bluebird, ruby shoes, lightening. Kelly Osbourne tweeted this: “I miss my friend. I’m going to be off Twitter for awhile. Thank you for all your support!” How many artists said the same exact thing when someone in their family died or a friend? Soulja Boy and Nicki Minaj both tweeted ‘thanks for the support’ or ‘i’m going to be off twitter for a while’. Always on twitter (bird dehumanization). The ‘support’ or thanking from their fans is part of the whole ritual sacrifice the feed off the mass media publication. The number 27 is a lunar symbol, for light in darkness or light itself. 27 Club consists of other artists specifically rock who also had problems with drugs, addiction, and substance abuse which led them to death or a ritual sacrifice. Note this. At age 27, there’s the highest brain activity, and then it starts to deteriorate slowly. That’s why it’s called the “Forever 27 Club” or 27 curse. It is linked with Mk-Ultra- living “forever young”. She was a blood sacrifice to Kelly Osbourne (most likely) and a planned out solstice sacrifice. It’s summer solstice and age 27 is lunar itself. R.I.P
Source(s):
http://mediaexposed.tumblr.com/post/7984…
2 years ago Report Abuse
7% 1 Vote
25 people rated this as good
kalcium
kalcium
The 27 club is also called the "Forever Young 27 club". Some say it's a blood sacrifice by the elite who control the music industry. These artists sell their soul, in trade for talent and fame, (like Robert Johnson - who also died at the age of 27), and then they die very young. Robert Johnson, is suspected of selling his soul at the crossroads (see his song "Crossroad"), and also predicted his early death. Before he made the alleged deal, he couldn't play the guitar well, but after he did, he became very talented, and came to be one of the most well known guitar players.

So it's kind of like a deal, you get talent and or fame, but you must die at the age of 27.

There are more than 34 artists, like
Jimi Hendrix - Asphyxiated on vomit.
Robert Johnson - poisoned.
Kurt Kobain - suicide by shot gun.
Brian Jones - died in a swimming pool.
Jim Morrison - no autopsy performed.
and Janis Joplin - heroin overdose.
Source(s):
http://tinyurl.com/3qxcnl4
Edited 2 years ago Report Abuse
20% 3 Votes
8 people rated this as good
Andrew Mazzeo
Andrew Mazzeo
Why do member's of the Illuminati die?
More than likely she tried to leave and once you're in there's no getting out. So she could have tried to expose them some how, she was a singer she could of had a message in her songs warning you about them, telling you about them.
The Illuminati have killed many famous people e.g:
Micheal Jackson the doctor ignored his calls for help.
Tupac : They killed him Via drive by then Killed Biggie Smalls ( Notorious B.I.G) a year later to make it look like a gang war. ( Bloods and Crips )
Many rich and famous people are in the Illuminati, Barack Obama, John McKane, Bill Gates any one rich and famous you can put money on it that they are in the Illuminati. The media are a HUGE part of the Illuminati they Control what you hear and see on the television and radio, Nearly every thing on the TV and Radio is a lie. Remember Bin Ladin? yer don't you find it a bit suspicious that they killed him before a big election? yer it's a conspirise they said they know'n his were about's for at least 3 - 4 months makes you think doesn't it? So yes Amy Wine house's death was the doing of the Illuminati, What was probably done was that they got her drunk, and drugged her, or they gave her beer or what ever she drank and then slipped a drug in there that will kill you if mixed with alcohol oh and also the JFK Shooting was also the doing of the Illuminati they could have found the killer they just chose not to further the investigation, They have done this with many celebrates killer's eg:
Tupac Amura Shakur, Biggie Smalls and JFK.
To answer you're question yes Amy Wine -House's death was the doing of the Illuminati.
Edited 2 years ago Report Abuse
0% 0 Votes
4 people rated this as good
indistress.damsel
indistre...
Its very simple. She was cancelling tour dates and messing up stage appearances - all of which was a great cost to her record company.


She promised to put out an album three years ago but refused to cooperate either due to her drug problems or manic depressive disorder which she refused to get help for.

All those rehabilitation programmes where also paid by her record company.

Although she is reported to be worth more than £10 million, I doubt she owned that directly in her bank account. She lived in a pokey flat in one of the poorest areas of London.

Her holiday to Saint Lucia (or somewhere) where she would have been sent to clean up her act in order to get ready to work on some new material were also propably a strategy of her managers and bosses.



Yet still she refused to get better. She was a PERFORMER - under an obligation to deliver the requirements and schedules as set out in the contract.


It is propable that like many young singers who had to deal with mental illness and drug abuse alongside fame, was killed off by the same people who give opened the door of fame for her.



She had been looking worse a few years ago when she was into hard drugs - yet she still recovered.



How then, was this woman, looking healthy just three days ago, out of doing hard drugs, suddenly died of an overdose?

Who was she surrounded by at the time? Who called the ambulance? Why is nobody questioned?

How come nobody considers this as a possible death caused by murder?

Because it is much easier to sweep things under the carpet and use the old excuse of drug overdose in order to maintains this practice.

Fame comes at the price of life.
Source(s):
Common sense. Now her goddaughter Dionne Bromfield looked more promising - young, fresh talent who will bring in high record sales because her tragic godmother urged fans to buy her album a few days ago. She will be announced as the protege of Winehouse whose name will be even more of a brand now that she has died so tragically.
2 years ago Report Abuse
13% 2 Votes
4 people rated this as good
Clare Brown
Clare Brown
i think it`s the illuminati apparently the people who are in illuminati stay in it for 7 to 8 years amy came out 2004 or 2005 right? count that up till 2011 it`s around 8 years or so she was about to release another album so mabye on her new album she wrote songs herself revealing what she goes through about illuminati and you could see how she hurts i think they were slowly killing her getting her on drugs and so on.... and other celebs who were in illuminati got killed at 27 so basically she was willing to reveal all about them and leave the illuminati but they got her :/
https://www.youtube.com/watch?v=G43DnaU9q…
2 years ago Report Abuse
0% 0 Votes
2 people rated this as good
BlueStar:)
BlueStar...
When these people have been under mind control drugs, they tend to try and break free from them as there mind is trying to come out of the control, this normally happens when they are approaching or are arund the age of 30 where they are at risk of being thrown of the 'train' as it has been called. ( Britney Spears - shaving head )
But to the Illuminati she isnt profitable enough to them alive and she is obviously in a destructive state so they basically just finished her off. She wasnt worth anything to them alive anymore. Just Like Michael Jackson, Marylin Monroe, Elvis.... They would do anything for money.
2 years ago Report Abuse
0% 0 Votes
2 people rated this as good
?
?
Have to agree with Stan, Amy did nothing and she was not going to expose anything, it was a plan to re-direct our attention from the debt crisis that is circling around the World, they do this sort of thing after the Bilderberg meetings and the Bohemian Grove 4 day richest men over 50 party.
Source(s):
The internet
2 years ago Report Abuse
0% 0 Votes
Chelsea Burkett
Chelsea Burkett
lol I love how the conditioned people try to convince everybody that there is no Illuminati, yet most of them actually never even research the subject, thus are unable to see the evidence.

Conditioned person: "Wait, what? The government regulated education system never mentioned anything about this. It must be a load of crap!"

The key phrase being 'government regulated'. They've been deceiving us since early childhood.
2 years ago Report Abuse
0% 0 Votes
8 people rated this as good
Iain
Iain
On the same day as the mass murder in Norway? Perhaps there is some news to be buried. Economic/ debt plan problems in the US being worse than we are led to believe for instance?

I'm not really a believer in the Illuminati though I do think there are some very nefarious people in positions of great influence and I do think it seems suspect that the post-mortem failed to find a cause of death.
2 years ago Report Abuse
0% 0 Votes
3 people rated this as good
Nok
Nok
Well nows shes in the 27 club, and let me tell you, its hard as hell to get in there because you have to be a famous musician and you have to die mysteriously at age 27.
NO CAUSE OF DEATH HAS BEEN FOUND YET. THAT MEANS NO DRUGS.

Her neighbors said they heard "Screams howls, and drums beating", at 2am the night Amy was killed.
She was killed by a group of loons.
2 years ago Report Abuse
7% 1 Vote
3 people rated this as good
Lady Lyrik
Lady Lyrik
For all of u ignorant ppl out there the illuminati does exist!. Hopefully one day u ppl will open ur eyes and brain to this .. I'm 18 and I first learned about it when I was 16 .. I strongly believe in the illuminati and how they want to control us .. but thank God I am an apostolic Christian and I am baptized in the name of Jesus Christ so I know watever happens I will go with my saviour.. so good day to all u closed minded ppl out there ..
Source(s):
Think of this.. if god were to cone this moment where would u go?. If u don't want to go to hell then repent and be baptized in the name of Jesus Christ ..
2 years ago Report Abuse
0% 0 Votes
6 people rated this as good
R. C.
R. C.
To the drug overdose comment. If this were true, the autopsy would have been conclusive, not inconclusive. Check your facts before spinning incorrect information.

Actually another report states. Drugs suspected, but NONE were found.
Edited 2 years ago Report Abuse
0% 0 Votes
1 person rated this as good
Terasgo
Terasgo
Portuguese- Ela em um show, estava bêbada, e ela falou que os illuminatis estavam vindo para matar todos que estavam assistindo o show, por isso ela morreu, Ela forneceu informações secretas.
2 years ago Report Abuse
0% 0 Votes
Harmonica79
Harmonic...
With out a doubt, I believe the Illuminati exists... do they have a connection with the 27 club... that's a stretch.
2 years ago Report Abuse
0% 0 Votes
Winehousefan
Winehous...
Can you actually die from drinking too much in one go? It's a bit weird that before they have a definite reason for her death, she has already been put to rest?!
Why would they kill her though?
2 years ago Report Abuse
0% 0 Votes
PcTran
PcTran
because theyre anus holes
Source(s):
me
2 years ago Report Abuse
0% 0 Votes
3 people rated this as good
Cleopatra25 by Cleopatr... Answer hidden due to its low rating Show


? by ? Answer hidden due to its low rating Show
Ben by Ben Answer hidden due to its low rating Show
Kevin by Kevin Answer hidden due to its low rating Show
☾ by ☾ Answer hidden due to its low rating Show
? by ? Answer hidden due to its low rating Show
Claire by Claire Answer hidden due to its low rating Show

Nonprophet by Nonproph... Answer hidden due to its low rating Show
Discover Questions in Celebrities

Do you think John Goodman is hot?
Concerts in Scotland 2014?
Does this mean you are famous?
Does anyone notice JOHN Lennon jaw went from square to narrow?

Trending Now
1
Adele
2
Nicole Scherzinger
3
iPhone rumor
4
Lobster shell disease
5
Kickalicious Lions
6
Northern Ireland
7
Deontay Wilder
8
Perseid meteor shower
9
PGA leaderboard
10
Typhoon Utor
Today on Yahoo!

Mickelson's atrocious shot is hard to believe


Phil Mickelson's terrible weekend gets even worse with this embarrassing swing.

Hundreds mourn artist who died after Taser stun


Things Detroit might sadly be forced to sell


Four foods you never have to throw away


Answers International

ArgentinaAustraliaBrazilCanadaChinaFranceGermanyHong KongIndiaIndonesiaItalyJapanMalaysiaMexicoNew ZealandPhilippinesQuebecSingaporeSouth KoreaSpainTaiwanThailandUnited KingdomUnited StatesVietnamen Español
Yahoo! does not evaluate or guarantee the accuracy of any Yahoo! Answers content. Click here for the Full Disclaimer.

Help us improve Yahoo! Answers. Send Feedback

Copyright © 2013 Yahoo! Inc. All Rights Reserved.

Copyright/IP Policy - Privacy Policy - About Our Ads - Terms of Service - Community Guidelines - Safety Tips

setember 5 2011


ANAHI, belinda, video

https://www.youtube.com/watch?v=-wXoJ9i_vgE

All three girls were replaced with reptilians. Now they use mind control as part of a Flu Shot/ Fluoride water conspiracy. The girls are being held in Chilo Ohio at Illuminati headquaters. They use monarch programing, all seeing eye, skulls and checkerboard pattern.

15 JULY 2011

DULCE MARIA

https://www.youtube.com/watch?v=iwcG_GmqRcU

http://foro.univision.com/t5/Anah%C3%AD/me-pregunto-seriamente-si-anahi-sabe-algo-sobre-la-simbologia-d/td-p/404289489/page/6



Regresar a Univision.com

«Regresar a Univision.com
Ingresa
Inscríbete


AMIGOS
ENTRETENIMIENTO
DEPORTES
NOTICIAS
NOVELAS
MUSICA
MAS
Foros > Música > Anahí
0

Responder
Opciones del Tema
« Lista de Temas
« Tema Anterior
Próximo Tema »
« Anterior
1
…
5
6
7
Siguiente »
Necesitas ingresar para participar. Login | Regístrate
isabela20
isabela20
Platino Brillante
Mensajes: 15,986
Temas: 194
Kudos: 291
Registrado: ‎04-14-2009
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-03-2010 08:45 PM


maringa90 ha escrito:
yo creo que anahi no tiene ni idea de ese tema (sobretodo teniendo en cuanta que si ve a su alrededor, en el mundo de la musica, los "mas grandes" hoy en dia hacen lo mismo), ella hace la coreo que le mandan y ya.. como tu dices.. guillermo si debe saber algo.. o mas bien mucho :que_importa:
aunque a veces dudo de lo de any.. por como hablan sus amigos.. el mundo elitista en el que parece que esta viviendo ultimamente... en fin, ya se ira viendo..



¡¡Matt Bomer mi único CHRISTIAN GREY!!

♥ Quien ama no destruye ni se deja destruir ♥

♥ Blog de Novelas ♥ ♥ Mis Web Novelas ♥

♥ Twitter Novelero♥ ♥ Descarga mis WebNovelas ♥
Reportar Mensaje
Mensaje 51 de 63 (501 views)

Responder con Editor Avanzado
Diamante nevergrowup
Diamante
nevergrowup
Mensajes: 29,437
Registrado: ‎04-30-2007
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-04-2010 05:31 AM

estaba viendo el video de me hipnotizas q x otro lado amoo
puede q siga la coreo pero quien hizo la coreo no es taan inocentee


me hipnotizas y caigo ante tí de rodillas,
hay algo en tus ojos que amo amo te amo amo te amo mi amor!
Reportar Mensaje
Mensaje 52 de 63 (473 views)

Responder con Editor Avanzado
Diamante samyspears
Diamante
samyspears
Mensajes: 32,596
Registrado: ‎03-27-2006
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-04-2010 09:53 AM


sarasisoyyo ha escrito:

loverbd100 ha escrito:
Esto es montarse peliculas y lo demas es tonteria.

No creo que haya nada oculto, y si asi fuera QUE? Any puede ser de los iluminatti, de los masones o de la cienciologia si quiere... mas miedo me da la iglesia catolica, que esa si hace de todo y nadie se da cuenta.
Amén!!! Y nunca mejor dicho!!!!

la iglesia catolica es controlada por masones, es la misma cosa.

Reportar Mensaje
Mensaje 53 de 63 (464 views)

Responder con Editor Avanzado
Diamante samyspears
Diamante
samyspears
Mensajes: 32,596
Registrado: ‎03-27-2006
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-04-2010 10:05 AM

para ser Illuminati hay que ser descendiente de una de 13 familias que siempre han estado en el poder, estas familias solo se casan entre ellos y rara vez tienen fugaz (cough obama cough) que son controladas y terminan regresando al circulo. Anahi NO ES Illuminati porque no pertenece a estas familias, practicamente NINGUN artista del mundo es Illuminati, no importa que famoso sea o cuanta simbologia de ellos use. La mayoria de las personas que tienen una posicion de mucho poder en el mundo (artistas, politicos, ejecutivos) trabajan para los Illuminati consciente o incoscientemente, eso es muy diferente a ser uno ellos, de hecho, TODOS, cooperamos en ese trabajo porque promovemos y promulgamos sus agendas e ideas porque asi no lo han enseñado en nuestras culturas, el secreto esta en que sea oculto el significado de las cosas. Anahi debe saber algo pero eso no quiere decir que este enterada de donde esta parada, no tiene idea de la dimension real de todo, como la mayoria de las personas. A Anahi se le educó para buscar la Iluminacion y promoverla; eso no es su culpa, ella nacio en ese mundo.
Reportar Mensaje
Mensaje 54 de 63 (462 views)

Responder con Editor Avanzado
Diamante nevergrowup
Diamante
nevergrowup
Mensajes: 29,437
Registrado: ‎04-30-2007
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-07-2010 06:43 PM


samyspears ha escrito:
para ser Illuminati hay que ser descendiente de una de 13 familias que siempre han estado en el poder, estas familias solo se casan entre ellos y rara vez tienen fugaz (cough obama cough) que son controladas y terminan regresando al circulo. Anahi NO ES Illuminati porque no pertenece a estas familias, practicamente NINGUN artista del mundo es Illuminati, no importa que famoso sea o cuanta simbologia de ellos use. La mayoria de las personas que tienen una posicion de mucho poder en el mundo (artistas, politicos, ejecutivos) trabajan para los Illuminati consciente o incoscientemente, eso es muy diferente a ser uno ellos, de hecho, TODOS, cooperamos en ese trabajo porque promovemos y promulgamos sus agendas e ideas porque asi no lo han enseñado en nuestras culturas, el secreto esta en que sea oculto el significado de las cosas. Anahi debe saber algo pero eso no quiere decir que este enterada de donde esta parada, no tiene idea de la dimension real de todo, como la mayoria de las personas. A Anahi se le educó para buscar la Iluminacion y promoverla; eso no es su culpa, ella nacio en ese mundo.

Ok gracias x la aclaracion samy.
rectifico la pregunta sera o no anahi consciente de q trabaja para ellos?
me hipnotizas y caigo ante tí de rodillas,
hay algo en tus ojos que amo amo te amo amo te amo mi amor!
Reportar Mensaje
Mensaje 55 de 63 (436 views)

Responder con Editor Avanzado
miarebelde1
Platino Brillante
miarebelde1
Mensajes: 15,261
Registrado: ‎08-09-2006
me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-30-2010 01:10 AM

mMMMMMMMMM INTERESANTE -.- BUSCARE INFO XQ NO CREO K ALGUIEN ME KIERA EXPLICAR MAS CLARAMENTE :smileyvery-happy:


Reportar Mensaje
Mensaje 56 de 63 (415 views)

Responder con Editor Avanzado
ketyany
Papel
ketyany
Mensajes: 1,486
Registrado: ‎03-26-2010
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-30-2010 03:25 AM

Que mie*rda :chinito: Siempre con algun estupideses :chinito: Anahi no tiene nada que ver con estos locos, Gayllermo puede ser :indiferente:
>
Reportar Mensaje
Mensaje 57 de 63 (403 views)

Responder con Editor Avanzado
dulcechoc
Junior
dulcechoc
Mensajes: 80
Registrado: ‎09-29-2010
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-30-2010 04:31 AM

ps yo como fan de dul pienso q anahi no tenga nada con ellos, pero dul en ultimamente es muy rara, se comporta como "la mujer de rojo" y este simbolo es el arma principal de los illuminates :asustados:



Reportar Mensaje
Mensaje 58 de 63 (395 views)

Responder con Editor Avanzado
claraisabell171
Platino Brillante
Mensajes: 16,490
Registrado: ‎06-14-2007
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-30-2010 05:31 AM

Y Como te diste cuenta de eso?? No tengo información sobre el tema, pero sí es cierto que muchos de los comerciales publicitarios que ahi en la tele tiene mensajes "subliminales" (por asi decirlo) para que la gente compré el producto que el mercado saca. Sobre Kdabra, bueno, está más que obvio que el escritor (a) tiene información inimaginable sobre los temas que trata la serie; la serie es buenisima pero tiene cosas realmente ocultas que van más allá de la fantasia.....

Reportar Mensaje
Mensaje 59 de 63 (384 views)

Responder con Editor Avanzado
Diamante beitaany
Diamante
beitaany
Mensajes: 64,801
Registrado: ‎05-12-2008
Re: me pregunto seriamente si anahi sabe algo sobre la simbologia d su video
Opciones
Publicado: ‎09-30-2010 08:09 AM

sigo sin entender :smileyvery-happy:
Simplemente estaré con ella por y para siempre; Anahi Giovanna Puente Portilla ♥
Reportar Mensaje
Mensaje 60 de 63 (233 views)

Responder con Editor Avanzado
« Anterior
1
…
5
6
7
Siguiente »
« Lista de Temas
« Tema anterior
Próximo Tema »
Responder
Crear Nuevo Tema

PJ Sitio Oficial
Fotos
Videos
Entrevistas en Video
Moda
Fan Cam
PJ en UVIDEOS
Más...

Desarrollado por Lithium
Más en Univision
Diabetes. Qué es. Causas, tratamiento y tipos.
Diabetes. Qué es. Causas, tratamiento y tipos.
Lupita Jones reveló su secreto de la eterna juventud
Lupita Jones reveló su secreto de la eterna juventud
Rara enfermedad cerebral afecta a hispanos
Rara enfermedad cerebral afecta a hispanos
recomendado por
Enlaces Patrocinados
Rentrée étudiante à l'EPH
Dernières admissions possibles! en COM, Tourisme, Evénementiel.
www.leph.fr/rentrée
Tout Coller
Conseils, Astuces et Idées déco ! Tout décorer, réparer et fixer .
youtube.com/toutcoller
Garde de chat
Garde de chat à votre domicile La passion d'abord!
www.monchatestservi.fr/

Foros Acceso Rápido
A / Z
Contáctanos
Eventos
FAQ
Regístrate
Top del Mes
Secciones de Foros
Amor y Amigos
Artistas
Ciudades
Famosos
Horóscopos
Noticias
Nuestra Belleza Latina
Países
Reinas de tu País
Religión
Teens
Telenovelas
Sitios de Univision.com
Autos
Belleza y Moda
Casa
Cocina
Deportes
Dinero
Entretenimiento
Cine
Música
Noticias
Novelas
Tecnología
Vida y Familia
Videos
Foros
Mi Página
Móvil
Videojuegos
Mapa del sitio | Recibe newsletters | RSS
Términos de uso (Terms of Use) | Política Sobre Privacidad / Sus Derechos de Privacidad en California (Privacy Policy / Your California Privacy Rights)
Anúnciate ya (Advertise Now) | Media Kit | Jobs | Información de la Empresa (Corporate Information) | Ad Choices en Español (Ad Choices)
Copyright © 2012 Univision Communications Inc. All rights reserved.
TRUSTe online privacy certification

anahi = illuminati


Conhecereis a verdade e ela vos libertará! (João 8:32)


HOME
MENU1
MENU2
MENU3
THEME LIB
About me
Contact me
Visit my blog

Anahí – Mi Delírio
| 0 comentários ]



Anahí, a Mia do RBD apostou na carreira da música de vez, e oque já não é surpresa a ninguém, está no 5º lugar do top 10 da MTV (Emissora maçonica)

Analizando seu novo clipe, "Mi Delírio" é evidente a tamanhas simbologias que encontramos, é incrivelmente engraçado, o quanto a indústria cada vez está expondo mais as coisas, vejamos trechos do video clipe:





Primeiramente, o bizarro acontece, ela está em uma clinica sombria para pessoas perturbadas (cenatorio) isso já não foi visto antes (Sucker punch) O Ambiente é bem parecido também, sombriu e aparentemente abandonado, esquecido...



Eis que então, surge a cena em que Anahí é colocada deitada e alguns supostos "médicos" a amarram, e começa então uma sessão de chock...


Mk ultra? Sim....


Bonecas simbolizando a inoscencia de Anahí referente ao controle mental?

Há uma TV fora do ar no fundo do cenário, seria para simbolizar que ela está fora de si, está sendo controlada, e manipulada?


Anahí dança com seus "amiguinhos" você vê o sinal que ambos fazem?



Ela aparece várias vezes no clipe dançando, com a imagem de Jesus Cristo cruscificado de fundo, porque quando há cenas sensuais, há a imagem do unico Santo, o homem que foi o mais puro do mundo de fundo?

Para finalizar, a indústria da música quer atingir todos os povos, de todas as linguas, o espanhol é um dos indiomas mais falados no mundo, isso é uma ajuda em tanto para eles.

Está ai, mais uma artista, controlada por eles, os Illuminatis,que de illuminados não tem nada.





0 comentários
Postar um comentário

Postagem mais recente Postagem mais antiga Início
Labels
A mídia impõe (2)
casamento (1)
Corrente de E-mails (1)
costumes pagãos (3)
Filmes e suas simbologias (1)
Foto mensagens (3)
homossexualismo (1)
Illuminatis (2)
industria da música (4)
Midia Illuminati (1)
Relacionamentos (1)
Senso crítico (1)
Simbologias illuminati (1)
Blog Archive
► 2012 (
► Fevereiro (
▼ 2011 (15)
► Maio (2)
▼ Abril (4)
A Influência da música nas crianças.
Novo clipe de Britney Spears- Till The World Ends...
Vinheta MTV
Anahí – Mi Delírio
► Março (4)
► Fevereiro (3)
► Janeiro (2)

Copyright 2008 Verdade Ignorada - Entries (RSS) - Comment (RSS) Design by Michael Jubel | Arthemia Template by ThemeLib and Make Money Easy

http://verdade-ignorada.blogspot.fr/2011/04/anahi-mi-delirio.html

Site hosted by Angelfire.com: Build your free website today!

Close Ad






FORUM EXCERPTS: SUMMARY "THE NOBODY"



The Nobody ~ "The One"

2/18/2012 User ID: 11068292

a quick summary from amongst the mountains of shrill trash.. To my Swedish friend.

A few notes about the True Man show. Just as scientists think they understand the nature of the universe, and how it works... And how religious fanatics and cult members think they understand their sacred texts...

When those who have watched the show understand what actually occurred and how the show was about the perceptions of the watchers, they will become enlightened.

They think that they were the voyeurs, but they were learning a story. A story in which none of the details were on the surface.

They will find that the show was about them, and that the character was the author of the screenplay, indeed the maker of the television. If their ego and logic can survive this they will become enlightened for the effort, and will taste of the ways of the angels.

The illuminati will learn that they have only been children watching a show designed to educate. As of this day the education is not complete, it will be though.

The nobody is as much an actor as he is anything else... And a consumate professional at that. The nobody not only can turn sideways and slip between the cracks in the matrix, he understands the knowledge of the Logos.

He did his performance on stage with every angle scrutinized by the best minds planetwide, and to this very second they have no idea what really happened in front of their eyes.

No one is more deceived than he who thinks he sees all.

When it is learned, the part that can be taught, what has actually happened, they will be amazed. Like the child who learns the sophistication of animation and television's many satellites.

The part of the illuminati is to now fall from the heavens of knowledge, to fully comprehend how little they knew. To become faith filled babes of the universe. They are not outside of the crib, they are inside of it. Their father himself produces their movies to teach them wisdom, and he plays all of the roles.

It was said before in this thread, the nobody is not spied on, the nobody is witnessing. Those watching are being observed to see if they may leave the crib, or if wisdom must come from a more stunning route.

The message from the Logos is "Be still, and know that I AM God." This is an incredibly deep and sacred working. It requires an inversion of previous understanding. They now learn that all of the "power" of this Earth is nothing against a nobody... And despite their best efforts they have only handfuls of wind as to how it is done.

Without faith they will not survive the upcoming transition. The children of the Kingdom are more powerful naturally than the armies of this world. And baby God is omnipotent to the adults of this realm.

All will be wiser as soon as they start from a place of sincerity and foolishness. To lose their wisdom so that they may become wise. Whether consumed in war or rewarded for their efforts, the Kingdom will bring new comprehension and understanding of a sort and caliber never dreamed of before. The ride is just getting started, and it is led by a baby who had conquered time and space and sees nothing as a challenge.

You do not wait for the Nobody, the Nobody waits for you. ...

~=~ -:- ~>>-<>~+~<>-<<~ -:- ~=~

"13" User ID: 960594 United States 07/01/2010

thread: "The Illuminati was made a offer they couldn't refuse."

"Don't ask me how I know this but the lack of doom lately is caused by a wildcard, someone who the Illuminati did not expect. This person apparently came out of nowhere, he is a nothing a nobody, yet much hangs in the balance because of him, lol that's God for ya. Everything is delayed until this issue is dealt with, rumor has it around July 4th it could be concluded. Then again it could get dragged on, I truly do not know.

Know this, God takes what man considers to be nothing, and makes him everything. God has done this more than once, and this time so much hangs in the balance. For the people that are not in the loop, well you won't even know something extraordinary happened. When this issue gets cleared up the doom comes. Then once again God will take what man considers to be nothing, and make him everything.

I asked for people to not ask how i know what I know. I know someone will pester me on how i know such things. Well this is what I can say. I am a bird on a branch and i am looking into the room where the Illuminati meet, that is how i know what i know."

For those who believe, no explanation is necessary, for those who do not believe, no explanation is possible.


=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-


[Excerpt]

*******************************************

? "..... i speculate that God will use this man somehow, to change the future".

**********************************************

? This nobody apparently has God's blessing because he is still alive. If any other person did/said the things that this man did/said, they would have been dead in a nano second."

".....I can not elaborate but let's just say this nobody, this little nothing, has balls of steel. In the beginning he was almost wiped, twice. He survived, now much hangs in the balance."

*******************************************

? "The contest is almost over."

*******************************************

? "Everything happens for a reason and now it is meant to happen."

*******************************************

? "he has a gift, and he is a game changer."

*******************************************

? "God I believe sent this man into their world for a reason" " much hangs in the balance."

*******************************************

? "There have been many attempts on his life. Only two seemed nearly successful."

*******************************************

? "Against this nobody...everything they do, for him, has already occured and nothing they do can be successful because it has already been defeated."

*******************************************

? "He is awake and aware and cannot be killed. A combination they cannot deal with."

*******************************************

? "Num 23:20 Behold, I have received commandment to bless: And he hath blessed, and I cannot reverse it.
Num 23:21 ....Jehovah his God is with him, And the shout of a king is among them."

*******************************************

? "Dan 2:44 And in the days of those kings shall the God of heaven set up a kingdom which shall never be destroyed, nor shall the sovereignty thereof be left to another people; but it shall break in pieces and consume all these kingdoms, and it shall stand for ever."

*******************************************

? "this guy is the 'once and future king'"

*******************************************

? "they were aware of who he truly was.. since birth. quite an unfair advantage they had in making sure he stayed within their construct."

*******************************************

? "he is a Monarch who figured all these things out on his own, otherwise, he would be dead."

*******************************************

? "... he became fully aware that he was put here to overcome their grip.. help overturn their rule.. help tear apart their own additions to the matrix.. which are many. once he knew all this.. there was no turning back."

*******************************************

? "FACT is – they already HAVE lost the game!"

*******************************************

? "he started talking openly about who he was.."

*******************************************

? "Perhaps some historical context;"To Dagobert II, King, and to Sion belong this treasure and he is there dead."

*******************************************

? "God uses the foolish things to confound the wise.."

*******************************************

? "...This one that holds back doom doesnt even know that what he says comes true...everything."

*******************************************

? "Mr Nobody does things that simply are natural to him. It's really nothing extraordinary at all; it's just natural and can't be explained."

*******************************************

? "He has said himself that he is not special. It is God who is special. God is showing who HE is through this man. He has not been killed because the hand of God is on him."

*******************************************

? "The NoBody spoken of by the OP Has lineage to ADAM through Joesph the First Israelite."

*******************************************

? "Furthermore, "the one" doesn't have tainted hybrid blood. Complete BS disinfo. His bloodline is pure, just as Noah's was."

*******************************************

? "He Is Licensed Bonded and Insured By the THRONE OF GOD to DO GOD's WILL."


~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Excerpts From a Post: It is all very real. I know what I am telling you is true. There are others here as well.

...So the man that did return came and made his claim and made it in such a way as to be a good time joke. So he was at first observed. Some people are such observed by secret societies as if they were the television programs of the day for the elite. And such was the case of this nobody.

However the story just kept growing over decades, and it has more twists, that it gained more ground in the conscious state of the planet. However the story had problems such that the nobody was seemingly unaware that he himself was a product of the dark order of the evil end of secret societies. They thought he was a mind control slave going mad. They thought many things of him but they were wrong because their minds betrayed them as they were acting as their own bias gatekeepers from the truth.

Even now their wispers credit him for being some type of super genius pulling off a feat so great it is mind bending, but that's just their own minds not willing to see that he was in fact telling the truth the whole time.

... there are forces. These forces can be effected by the free will event that is in the human condition...

And this "Nobody" who started out being more a joke then jester slowly over time became a well known (professor) of things beyond their understandings. Things they have had to pay dearly to find out and even in their knowledge are only babes learning. And the nobody knows more then them. And they don't know how. But some are finding the faith required to see it.

Some are just finding the will to wonder. And some are even beginning to believe.

i shit you not. that one they call the nobody is the second coming of christ. You see the term "christ" is chosen by God. As of yet "God" the grand master has not revealed to mankind, nor those in the know, that this one that seems to be a man is in fact the one that is to come. Yet he steals all their secrets as if he were a master thief in the midst of night catching them asleep and very unaware.

The story is a fine one. It is very real. They all want to "advise" him. It is them that need be advised by him. One once said "he has more friends then he deserves". That is not true at all.

He has more unfriendlies then he should because they know they are not in control and their own lust for power eats upon their corpse of their very souls.

~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Posted by Swinging on Spirals: Not sure if I can explain it properly. I kind of 'see' gaps in information. I don't know how to express that correctly. But, to make this brief, I 'feel' like I know what this guy would have to be like. I don't know 'who' it is, but I know what his personality would be like. This is way outside all the 'CIA' tried to kill him bullshit.

He is 'hidden' from them because the work that takes place is not so much in the 'material', but he ends up 'influencing' the material.

This 'influence' cannot be pinned down, because it doesn't originate in the material...so, it could be ANYBODY. But, if he was 'elite' or in the Illuminati or things like that, then they would have been able to figure out who it was through energy signatures, bloodline, most likely candidates, etc.

We hear it over, and over, and over. That he has 'God' on his side. Why do people say that? Because he is 'working' in the non-material, which ends up manifesting in the material.

But They don't know how someone could possibly do that, because it is so extremely advanced. They thought no one could be more advanced than them in the non-material aspects of controlling how majic manifests into the material.

He literally does stuff that is impossible to Them. Their only answer to this is to say that he is working through God...or actually, God is working directly through him.

HOW does a human do what Nobody does...ie, working in the non-material with absolute precision and in such epic sized changes, and yet remain invisible?

So the hunt was on. To find him through astrological charts, personality profiling, ancient texts, areas that have been influenced, etc. Imagine what 'They' have at their fingertips for this kind of search! Data-mining, phishing, red-flagged words and topics, narrowing down the field.

Eventually 'They' would find him. Try to use him...not 'arrest' him or try to murder him. They would want to find out who the hell he could possibly be. Different agendas, different factions, all having different ideas as to what to do...ripping Them apart...by his influence.

You see, he didn't have to do anything! The mere knowledge as to who this guy was, created enough of an influence to shake Their foundations. Uhoh, take a step back, reorganize. Get AWAY from his influence. Start tracking him, find a weakness, and go exploit it.

So they start, and every time, they fail. They think he has weaknesses, but the weaknesses just do not exist. They are like illusions. He just walks through all the mind games, all the nightmares, everything They throw at him (not necessary physical, but those started as well), as if he is God's gift to badasses.

So, now, he has basically 'won' the game. His influence is changing everything. The good guys, the bad guys, everyone is 'liking' this guy.

They start throwing everything at him. See how much knowledge the guy can soak up. See how much he can 'play' in the non-material. Phish, and ask questions on forums where he frequents...try and understand how his 'mind' works. What he likes, dislikes, what he thinks about. They try and start 'using' him, his thoughts and mental abilities. He doesn't mind.

He understands what all this is doing. It is creating an influence directly from him (Source) and is embedding it into EVERYTHING. Here on GLP, maybe where he visits, they put out feelers on threads. And, when specific information is brought up, or needing to come out, or needing to be relayed, you get all these people playing at roleplaying...convoluting everything.

They do not want to expose Him yet. They are teaching him things, just as he is teaching them things. Why? Again, to embed his influence into everything.

Got to wait, until planetary alignments, political situations, etc., etc. are all in place. And then it will happen"

-------------
"If he is going to stand up, then he has to prove who he is. Otherwise, there is absolutely no sense in standing up.

What could there possibly be as proof? I know how it would have to roll out...anyway... It will not be a person standing up proclaiming he is the one. IMO, he would never proclaim himself to be the one. Again, there is absolutely no reason to do so.

If he exists, he is the message. He is not a messenger. In other words, people will not need to be told he is the one. Circumstances will dictate that he is the one...period.

What would the roll-out consist of? Everything converging in his direction. Everything converging to his lines of 'thought'. It should be a natural convergence, though I am positive some will try to capitalize on it, perhaps be trying to preempt the natural roll-out. Which, when people proclaim that they are the One, is exactly what they are trying to do.
~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Another post: The One thing noone has realized is If/When The Nobody Quickens and Becomes Manifest There are 144,000 Souls/Bodys/Brains (Those who are Sealed) come On Line as they are Linked to the Manifested ONE.

When this Happens the ONE Is Connected to The Throne OF GOD and Has the FULL Power of God.

Yes you heard that right. and This is What TPTB Fear...

So Now you KNOW the Full Impact this Person Can have on this World we live ON... really?

~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Re: ~The Nobody~

Hi.. ? Australia
04/13/2012 08:40 PM

Spiritual Hierarchies rule the day, waiting and prepping manifestation of one that they looked for and found. They founded the bases of a Godlike Production within the embodiment of Trinity, their own play of archetype manifestation and word play.

They had known someone had arrived, and it was a someone that they were expecting. This individual surpassed their wildest expectations in the speed of his growth and abilities of understanding knowledge and thinking thoughts far outside the common ideologies.

Ripples were sent out, and they manifested within the entire psyche of the forum, saturating vibrant thoughts with clarity and ease.

They wanted him to slow down as he went way ahead of their timeline they had planned for him. The vastness of his abilities and nature ease of dissemination was an unexpected and pleasant surprise.

Now, copy and paste the above into a new thread...and see how fast it gets deleted.

--------------------------------

~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Re: Instructions for the Nobody
11/09/2012 Quoting: c.d.

"... I know there are some people on this site who KNOW things. Im sure they could give this guy...whoever he is, a head start. maybe a little direction, we all know it's going to happen sooner or later but why wait longer than we have to?"

=================================

{Reply} 11/09/2012 Anon. _____684

That's not how the rules were written. There was very little that what you call "The Nobody" could be told or helped with.

He had to choose his own path without influence.

He was the object of a contest to tempt him into serving Evil.

In a previous time he was a most determined servant of God. He walked with God.. In a way they were like best friends.

Evil didn't like that and declared that in a different situation Evil could get "the nobody" to be wicked.

And so.. the Nobody had to make a choice on his own with no clues as to who he was previously.. or even what was going on this time.

He had to be unknowing of what he was a part of.
Don't worry.. he choose good.. to "do what's right".. again, in this time... [happened about 50 years ago].

It hasn't been easy at all.. but as the puzzle has filled in since his original choice.. he's grown in knowledge and never once changed his mind about "doing what's right".

And I really mean it hasn't it hasn't been easy.. for a long time he didn't know who he was previously.. but many wicked ones did and they tried to make it very difficult for him to remain true to his choice.

Anywho.. that was then.. but now is here.. You might not realize it, but the wheels of Evil's demise, both human evil and spiritual evil, are already well in motion.

Evil is done. And those TPTB humans who serve Evil know they have little time left and that their master is the loser.

~=~ -:- ~=~ -:- ~>>-<<~>>~+~<<~>>-<<~ -:- ~=~ -:- ~=~

Re: who is the NOBODY?

02/20/2013 Anon. ID____026

"is that what they really say about this guy? any idea on how he took down the cabal?"

(reply)

".....absolute authentic adherence to his self and refusal to submit through will and discipline......."

Anon.

"do you know what caused the electromagnetic shift? was it the nobody that 'pushed them back', so to speak? what did he do so special?"

(Reply) Xeno00000 ID: _____122

"divine faith and iron will hard work, no shortcuts... inch by inch, relentlessly. the war horse scene is very accurate where he ran through the barbed wire fences in no man's land till collapsing on the ground. imagine doing that 10000 times within a few years... that is what was needed to break through.

the higher energies also needed to be brought in, which they were... only trickles are apparent to most but they will soon be mega tidal waves... nothing really special about it other than no other human having done it or being prepared to do it as the price to pay is very high and all this with no logistical support from any human. "

~=~ -:- ~=~ -:- ~>>-<>~+~<>-<<~ -:- ~=~ -:- ~=~

J. - United States
05/07/2013 12:44 PM
User ID: 10872394

Re: Question for The Nobody

TPTB fear "him" simply because they have no power over him.

They have tried and tried, indirectly and through third parties, to control him the whole way through. He has, instinctively as opposed to consciously, resisted them the whole way through. They cannot sway him. they cannot manipulate him for long before he realizes it. they cannot change who he is at his core, no matter the painful circumstances that they create for him. When it comes to him, they have absolutely nothing.

That right there, having ABSOLUTELY NO POWER OR CONTROL over something, is the most terrifying thing TPTB could ever possibly imagine.

If they all stood before him, their collective will, all of their resolve, would crumble to dust in an instant. They would be finished, he would not have to lift a finger, and they know this.

They know that everything that they are is an illusion, and they are running scared from the shattering.

It is the fact that he desires absolutely no power over them that makes him the good guy. Trust me, he certainly has the potential to be the baddest bad guy ever.

He just has way too much heart. Good for us, bad for him, as he has used that heart as a weapon against himself for far too long now.

Which is why he is here now. not to save us, but to learn to not destroy himself. When are you guys going to get that? He is not here to save you from yourselves. He is here to save himself from himself.



~=~ -:- ~=~ -:- ~>>-<>~+~<>-<<~ -:- ~=~ -:- ~=~

"New Thor" United States
10/21/2012 - User ID: 12990389

Re: is the nobody alone?

In everyone's passion to understand the Nobody, there is a lot of traits being projected onto this person to suit the ego of others, me thinks.

I think Me and Y'all are talking about the same entity, you guys call him the Nobody, Nostradamus called him the Hercules of the Fluer de Lis, so call him the Alpha Omega Manchild, the Unicorn or whatever floats your boat, it's all semantics really, and communication break downs are the bane of society.

This person is not some loveless man sitting in a trailer park in Iowa...C'mon, brothers and sisters. Someone like this would have to be filled with Love and have a heart that radiates like the strongest of stars.

Just like Ender Wiggin in Ender's Game, he'd have been born for this, bred for this and been trained and tested every single day.

Just like Howard Roark in The Fountainhead, he would be a grand artistic architect that could take the world, erase it and then rebuild it in his mind again and again and again.

He would have to have an Aura so strong, it makes the subconscious of all TPTB around NOT want to take his life for they know they would suffer a universal fate of Judas, being reincarnated down, down, down.

The Earth silently waits for him to pull Excalibur from the stone and cut the Gordian knot causing the Kandor bottle to vanish. - Vaya con Dios.



~=~ -:- ~=~ -:- ~>>-<>~ ~<>-<<~ -:- ~=~ -:- ~=~ -


~=~ -:- ~>>-<>~+~<>-<<~ -:- ~=~

WEBSITE =>







Site hosted by Angelfire.com: Build your free website today!
Sponsored by sponsor logo

threedeafwords.com
SearchMain menu
Skip to primary content
Skip to secondary content
Home
Sample Page
Post navigation← Previous Next →
Nobody’s Angel, Story of Child Ritual Abuse & Multiple Personality Disorder
Posted on February 8, 2013


Almost eight years ago, I listened to an internet U.S. radio talk show and they interviewed Greg Reid on it about his being a child ritual abuse (SRA) survivor.

http://www.amazon.com/Nobodys-Angel-Gregory-R-Reid/dp/1597812080

Reid was warning North Americans about the dangers of Halloween and certain covert celebrations involving Satanists who often are white collar professionals or the political elite.

October 31st or Samhain is one of two most important satanic ritual celebration days, the other being Beltane, May 1 &/or a Wiccan Sabbat.

On October 31st, historically Satanists offer animals and/or humans to Lucifer where the bigger the sacrifice, the bigger the demonic empowerment rendered to the worshipper.

That’s why the December 2012, Sandy Hook (Newtown CT) grade school blood ritual was staged.

Greg Reid was born & raised in California in the early 1950s.

He was ritualistically abused by a group of organized Satanists as a child in rural California, near legendary locations such as Box Canyon.

Reid states that in the 1950s/1960s, Box Canyon was definitely a Druid, Luciferian hotbed.

Filmed in Box Canyon in the 1960s, was the TV show the Wild Wild West which had strong satanic underpinnings in its script.

In this area of Southern California, there were a lot of damaged people living, from child to adult.

Some of the neighbouring children that Greg described being aware of while growing up there, were no doubt also victims of Satanic Ritual Abuse.

Hence in the 1950s and 1960s, Southern California was dominated covertly by covens, not just from the Hollywood cabal but the urban power players belonging to orgs like the O.T.O. Lodges started during WWI, by infamous British, hyper-Masonic, Satanist and black magician, Aleister Crowley.

This remains the case today judging how many Monarch programmed multiple, beta sex slaves are found among the young Hollywood stars, living and working in California.

These Hollywood stars are very obvious in terms of being mind controlled, beta sex slaves if you know what to look for such as Lady Gaga although she was programmed in New York City.

Lady Gaga’s music vids always tell you about her programming and THEY TELL IT VERY EXPLICITLY but the naive viewer cannot see the forest for the trees which is the exact response desired by the programmers.

The last 30 years of Monarch torture-based/Satanic-Ritual-Abuse-based mind control programming ops sanctioned by our rogue N.A. governments has managed to create an epidemic of psychotic children and adults.

Veteran Canadian psychiatrist Dr. Colin Ross (for the past 22 years he’s been working in Texas as a psychiatrist) stated in a Toronto, Ontario presentation in November 2012 that the reason why the Illuminati have not silenced him yet is that he only publishes and lectures on MKULTRA as a historical issue (past and now gone), and he must act as if the current Monarch programs HENCE MONARCH MPDs do NOT even exist although he admits that they are likely programming children under Monarch right now.

https://www.youtube.com/watch?v=29TZSBm-ggA

This is why the “Gregs” and the “Katies” of the Generation “X” and “Y” children in N.A. who were tapped under Monarch have less chance of being deprogrammed by the few moral psychiatrists out there, then the MKULTRAs who sought deprogramming by the 1970s and 1980s.

Greg was chosen not only by strangers to be a satanic coven initiate but by certain extended family members who allowed the thread of generational Satanism, to continue through to Greg but not through his other two brothers.

The other two brothers remained completely untouched and unaware of Greg’s shadowy world as a boy.

Greg was initiated into the coven by these Satanists via child/satanic ritual abuse techniques.

It involved mass rape, homicides, ritual abuse (dismemberment of live bodies and corpses, etc.) and other tortures and a lot of evil energy transference from the adult coven members to the child victims through sex magick.

Greg was groomed to sacrifice (murder) his best friend, another captive child of the coven.

His name was Mark.

Mark, Greg analyzed later was likely a child of a breeder so he likely had no official birth certificate that he even existed.

Covens like this one with affiliations to the rich & powerful of Hollywood, would have their own medical doctor or midwife on “staff” to deliver these babies.

Greg said, “Mark likely had no birth certificate. But in God’s eyes he existed. He exists to me.”

The back cover of Greg’s book, Nobody’s Angel © 2005, it states this of Reid: Gregory Reid has been in youth ministry since 1975 and has worked with at-risk youth including sexual abuse victims and occult-bound kids. He has conducted more than 250 training classes since 1987 for criminal justice workers, police officers, probation departments, and other professionals. He also has spoken extensively in churches nationwide on the dangers of occultism. Gregory is an ordained minister, has an honorary doctorate from Logos Graduate School, and has authored 11 books.

It appears that a lot of bad occult things happened to Greg & his few friends in the year they were “13” years old.

Ex-witch and great Christian teacher David Meyer, told us that “13” is a favorite number of both witches and Satanists.

Nick Bryant in his book, The Franklin Scandal: A Story of Powerbrokers, Child Abuse & Betrayal © 2009, tried to even stay away from covering satanic ritual abuse issues likely because he had only enough evidence for just the “nice” part of an elite child sex crime ring located in the U.S. Mid West (Nebraska) that dealt with child prostitution, group sexual orgies, drugging, child trafficking, and the making of illegal porn which included snuff films.

Why did Bryant not want to cover the satanic ritual abuse part?

Even though the North American public is deeply saturated with occult influences at every cultural level right now they do NOT want to know the ugly side of Evil.

They just want to hear about the beautiful side of Evil—that is white magic occultism.

If one talks of Satanism, one just loses credibility, even though the most likely to be serious Satanists in your town or city are the moneyed, white collar types, such as doctors, judges, lawyers, etc. who involve others—like police, morticians, politicians, teachers and pastors in their covert coven activities.

Bryant did reluctantly include evidence in his 2009 book that there was so much child ritual abuse going on in the U.S. and that when a hot line in one state was opened to deal with cases in the 1990s,–they received 23,000 phone calls in short order.

It’s time to call a spade, a spade.

The pro-homosexuality faction as lobby force in N.A. politics has not stayed static in its agenda to be recognized and accepted as a group with human rights in the past sixty years,—so why would child-ritual-abusing, elite Satanists stay as an unrecognized group, predating the human rights of our vulnerable minor-aged citizens?

This elite Satanic cabal rules us right now and they dictate ONLY that they have the rights to predate anyone else’s human rights as in their secular-humanistic, Freudian-psycho-ology-governed legal systems right now—with their mantra to adult predators as child molesters, being—DO WHAT THOU WILT, which is the worship of self or Satan.

If you are a child ritual abuse victim and don’t think you are able to survive the baggage you took on and you are now involved in a conspiracy of silence, shatter the looking glass, step out and speak up, no matter what the cost.

Yes, I also realize that the cost may be that the coven will take out the part of your family you love.

But before they do this, or can do this use social networking sites on the internet to go public.

Actually the 2012 Canadian Monarch programmed multiple, online porn star, Luka Magnotta (b. 1982) did the reverse engineering thing when he posted online in May 2012 his ritual slaying of a 33 year old Chinese man in Montreal, Quebec on bestgore.com.

His handler may have allowed this but Luka’s bigger message to CANADA was that he is a slave being forced to do ritual evil—PLEASE HELP ME!

These elite predator programmers do not want this kind of internet EXPOSURE—they must keep the public naive.

By going cyber and viral, you can give a voice to the children currently under severe ritual abuse who have no way out.

The very first time Greg as a child was sodomized by the coven adults, his psyche fractured.

David Icke describes this process well in his book Children of the Matrix © 2001.

This fracturing of the psyche used to be labeled by the mental health profession as multiple personality disorder (MPD) but in recent decades, it’s clinically called Dissociative Identity Disorder (DID).

Greg’s rehabilitation involved him being assessed by a Texan mental health professional who “tested” him and found him to have NO identity at all—hence he was DID.

But likely Greg has/or had, a certain number of personalities and alters but NO dominant one—so it looked like he had none.

However in late 2009 when I first learned about trauma-based & SRA-based mind control programming: Greg likely had a front alter.

Likely the day he was writing the psychometric test at the therapist’s office in Texas, he was rapidly switching personalities so his front alter could not present as the only one answering the test questions.

The MPD disordered psyche is created by DISSOCIATION by the child’s internal brain mechanisms, to cope with huge stress SRA/extreme torture abuse which causes a child to dissociate and forget, so that the child will self-preserve and not commit suicide.

One personality/alter can bury the memory of child ritual abuse and another personality can dominate the consciousness of the human victim (whether child or adult)—so they do NOT remember the severe abuse or the morbid details as long as they stay in that alter.

It’s not a perfect mechanism to stop these victims from going insane but it does work to keep them in a kind of shock condition so that they don’t go over board and commit suicide or something violent.

The MPDs and/or DIDs always have a severe, chronic Post Traumatic Stress Disorder (PTSD) profile.

They often are mis-diagnosed as paranoid schizophrenics.

There are ten recognized DSM-IV personality disorders by the American Psychiatric Association but there’s a lot more kind-of-recognized & categorized personality disorders, listed in the Diagnostic & Statistical Manual of Mental Disorders (DSM).

What’s important is that MPD and/or DID are real mental disorders!

Good psychiatrists are over-worked and often are the ones who can do an objective diagnosis of occult crime survivors being multiple personality disordered but many just are not available for these victims for one reason or other.

There are high functioning psychotic folk working in jobs right now,–some in the health care system, some as lawyers or judges, etc. and even politicians (this is common like in the cases of Hitler & Stalin, who both were paranoid schizophrenics and Hitler was MPD and programmed at Tavistock, London England in 1913 as a Zionist Rothschild offspring).

Greg Reid is among those who became transparent enough to gain wholeness and now he can help others do the same.

I did this review of SRA & Greg Reid’s story before December 2009 when I stumbled across the work of U.S. Fritz Springmeier’s and ex-mind control slave Cisco Wheeler’s on CIA/Jesuit/Tavistock–initiated trauma-based/SRA-based mind control programming of North American minor children to become induced MPDs and programmed multiples carrying out programming as beta sex slaves, Delta & Theta (psychic) assassins, super spies, super soldiers, super athletes, drug mules, etc.

They also use these children later as Satanic-illuminati-blood-line BREEDERS. This is eugenics.

Masonic doctors &/or midwives deliver the babies and there is no medical record.

Some get to live & assume aliases or they are sacrificed as babies in SRA ritual human sacrifice.

In the U.S. right now, there are up to 13 MILLION mind control slaves floating around in ‘’normal’’ society with many being sleeper agents waiting to be triggered.

Many are programmed serial sex offenders and/or serial sadistic killers and will be triggered to create severe havoc among the masses so they cry out in N.A. for a totalitarian police state for personal protection reasons.

In Canada, we host around 1.3 million programmed multiples with the older ones being MKULTRA and younger slaves being Monarch.

So how is it that so much severe and criminal child abuse could happen in North America in the past six decades and the public remains ignorant about it and/or they have been absorbed into the conspiracy of silence?

Hell burns hotter for enablers who could have done something about evil but did nothing!









This entry was posted in Uncategorized by . Bookmark the permalink.
Leave a Reply
Your email address will not be published. Required fields are marked *

Name *

Email *

Website

Comment


Proudly powered by WordPress

Godlike Productions - Conspiracy Forum
Users Online Now: 2,718 (Who's On?) Visitors Today: 1,314,799
Pageviews Today: 1,921,245 Threads Today: 624 Posts Today: 11,367
03:32 PM
Join Our: Twitter - YouTube - Podcasts
Donate To GLP
Directory
Adv. Search
Topics
Forum





Back to Forum
Post New Thread
Reply
View Favorites
Create Chat Room

Join Now, Free! (& No Ads!) Forgot Your Password?
Email
Password
Remember


Rate this Thread
Absolute BS Crap Reasonable Nice Amazing

Page 1 2BottomSearch RepliesPrevious PageNext Page
The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
e.Y.e
Offer Upgrade


User ID: 27484988
United States
02/27/2013 05:31 PM
Report Abusive Post
Report Copyright Violation
The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Starting the thread again as the last one got deleted.

I had a 19 page thread connecting the dots throughout so I'm doing it all over again this time just using music as it's much quicker. If you have questions feel free to ask.







Posting the songs in the previous thread that have nothing to do with anti-israeli messanges or the nobody. Even though there were no real anti israeli messages nad it comprised 1/20th of the thread of nobody talk.

Last Edited by e.Y.e on 02/27/2013 09:18 PM
1908247


User ID: 35266646
Brazil
02/27/2013 05:34 PM

Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump
- ? Nus.

-No cause is a lost cause if there is a fool to fight for it.


-'The day which we fear as our last is but the birthday of eternity.'

-You Hold Witness I Witness
Anonymous Coward
User ID: 35239615
United States
02/27/2013 05:35 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
hf
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 05:36 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Destroy my karma all you wan't. I don't care. My threads weren't abusive and you said remove the shitty part. At first it was said it was the nobody part in the title. You didn't say it was the thread deleted part till it was too late.

Thanks anyways.
Cheers.


Too anyone interested in helping reconnect the dots feel free to chime back in and help all over again.

Suggested pin.

Last Edited by e.Y.e on 02/27/2013 05:39 PM
1908247


User ID: 35266646
Brazil
02/27/2013 05:37 PM

Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Destroy my karma all you wan't. I don't cared. My threads weren't abusive and you said remove the shitty part. At first it was aid it was the nobody part in the title. You didn't say it was the thread deleted part till it was too late.

Thanks anyways.

Cheers.
Quoting: e.Y.e


Wow, it amazed me that the second thread got deleted even though you changed its title following instruction. Let's no longer discuss the deletion. (:

Good luck with this one. hf

Last Edited by 1908247 on 02/27/2013 05:38 PM
- ? Nus.

-No cause is a lost cause if there is a fool to fight for it.


-'The day which we fear as our last is but the birthday of eternity.'

-You Hold Witness I Witness
Anonymous Coward
User ID: 35281018
02/27/2013 05:40 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
A friendly advice. Don't even MENTION T.N. anymore.
IF you want to keep the thread...
Focus on the great work you do, WITHOUT involving the T.N.
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 05:42 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
A friendly advice. Don't even MENTION T.N. anymore.
IF you want to keep the thread...
Focus on the great work you do, WITHOUT involving the T.N.
Quoting: Anonymous Coward 35281018


I removed it from my previous thread and it still got deleted.

The sad thing is it took 6 weeks to connect all the dots in a coherent manner where a user could start from page one and get to page 19 and have a well formed proverbial web.
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 05:48 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
If anyone feels like re-doing it all over again feel free to help. I'll add things as time passes and I remember the proper things to say. Bump and flag as you wish.
Anonymous Coward
User ID: 35281018
02/27/2013 06:13 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
If anyone feels like re-doing it all over again feel free to help. I'll add things as time passes and I remember the proper things to say. Bump and flag as you wish.
Quoting: e.Y.e


I'm interested in how you shared about the nano-bots and smart dust/chemtrail conspiracy... as how many around us appearing humans are not.
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 06:34 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
If anyone feels like re-doing it all over again feel free to help. I'll add things as time passes and I remember the proper things to say. Bump and flag as you wish.
Quoting: e.Y.e


I'm interested in how you shared about the nano-bots and smart dust/chemtrail conspiracy... as how many around us appearing humans are not.
Quoting: Anonymous Coward 35281018


It doesn't mean they aren't humans. There could be a lot more people that have it than I presume, but it could simply be inactive. Perhaps they aren't in the first place humans but I'm stuck between perhaps they all are and are simply controlled by the bugs. Why bug machines if they are already with you. Remember the bugs cause pain etc. We are machines too. Just biological in nature etc.

The whole immortal technique thing is about a supercomputer controlling men. Not that they are necessarily machines themselves.

It's funny how at the end of men in black 3 the quote was "Don't ask for information you don't need to know". Or something like that it follows with wisdom is bleak etc.

I do believe the moon to be a satalite. Remember the saying shoot for the moon; even if you miss you'll land amongst the stars.

Last Edited by e.Y.e on 02/27/2013 06:49 PM
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 08:39 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
These might help people along the way.




e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 09:03 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You



Remember the dancer in I pet goat II video.






Acid raindrops is a reference to the bugs that were spoken about in a previous thread.



Last Edited by e.Y.e on 02/27/2013 09:04 PM
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 09:09 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
That's the quickest way of connecting the dots via music.

Look at the titles and then listen to each song.
e.Y.e (OP)


User ID: 27484988
United States
02/27/2013 09:21 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Love is the only way. If you seek justice you seek evil; if you seek good do good.
YosefHayim


User ID: 4436791
United States
02/28/2013 02:57 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You



Proverbs 12:1; Acts 20:25-27
e.Y.e (OP)


User ID: 27484988
United States
02/28/2013 06:37 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Amazing videos especially the second one.
e.Y.e (OP)


User ID: 27484988
United States
03/01/2013 08:51 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Easy E Spills it all then dies soon after.


e.Y.e (OP)


User ID: 27484988
United States
03/01/2013 09:44 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump
Organic Intel


User ID: 35502343
Sweden
03/03/2013 04:25 PM

Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Hi, you know who I am... you wanted to talk. I can't email as it seems I need an upgraded account for that... but I did create a profile. hf
Organic Intel
SOULJA
User ID: 34459147
United States
03/03/2013 04:32 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
Who cares? whatever is gonna happen is gonna happen. Nothing in this universe can change it. Just put on your seat belt and enjoy the bumpy ride. Do what I do and look out the window it helps distract me.
e.Y.e (OP)


User ID: 27484988
United States
03/04/2013 04:23 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
You should all read this thread. It gets to the bottom of it all. The bearer of false gifts which is grey-tech to the mark of the beast.

Thread: You Should Read This Very Enlightening Thread From Top To Bottom
Anonymous Coward
User ID: 9380226
United States
03/04/2013 04:46 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
You should all read this thread. It gets to the bottom of it all. The bearer of false gifts which is grey-tech to the mark of the beast.

Thread: You Should Read This Very Enlightening Thread From Top To Bottom
Quoting: e.Y.e


The greys aren't the bearers of false gifts and broken promises. They're the messengers warning us about the fallen angels we see as balls of light transforming into all kinds of craft/creatures in the sky sometimes right before our eyes. Many people have already connected the dots; it's so bizzare though it's too much for most people to handle. What is happening now has happened before so that's a good place to start in understanding what we're dealing with. Extinguishing the spirit of God in people using any and every available means is the end game. Those people are literally blocking the interdimensional infiltration that is rapidly increasing. Have you noticed the darker the world gets the more "UFO Sightings" we have?

It won't be just chopping off the heads of Christians, it will be anyone who is a light to the world regardless of their religious affiliation.
e.Y.e (OP)


User ID: 27484988
United States
03/04/2013 04:51 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
You should all read this thread. It gets to the bottom of it all. The bearer of false gifts which is grey-tech to the mark of the beast.

Thread: You Should Read This Very Enlightening Thread From Top To Bottom
Quoting: e.Y.e


The greys aren't the bearers of false gifts and broken promises. They're the messengers warning us about the fallen angels we see as balls of light transforming into all kinds of craft/creatures in the sky sometimes right before our eyes. Many people have already connected the dots; it's so bizzare though it's too much for most people to handle. What is happening now has happened before so that's a good place to start in understanding what we're dealing with. Extinguishing the spirit of God in people using any and every available means is the end game. Those people are literally blocking the interdimensional infiltration that is rapidly increasing. Have you noticed the darker the world gets the more "UFO Sightings" we have?

It won't be just chopping off the heads of Christians, it will be anyone who is a light to the world regardless of their religious affiliation.
Quoting: Anonymous Coward 9380226


I always imagined it to be grey-tech perhaps it's not and its simply man made.
Anonymous Coward
User ID: 9380226
United States
03/04/2013 07:01 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
You should all read this thread. It gets to the bottom of it all. The bearer of false gifts which is grey-tech to the mark of the beast.

Thread: You Should Read This Very Enlightening Thread From Top To Bottom
Quoting: e.Y.e


The greys aren't the bearers of false gifts and broken promises. They're the messengers warning us about the fallen angels we see as balls of light transforming into all kinds of craft/creatures in the sky sometimes right before our eyes. Many people have already connected the dots; it's so bizzare though it's too much for most people to handle. What is happening now has happened before so that's a good place to start in understanding what we're dealing with. Extinguishing the spirit of God in people using any and every available means is the end game. Those people are literally blocking the interdimensional infiltration that is rapidly increasing. Have you noticed the darker the world gets the more "UFO Sightings" we have?

It won't be just chopping off the heads of Christians, it will be anyone who is a light to the world regardless of their religious affiliation.
Quoting: Anonymous Coward 9380226


I always imagined it to be grey-tech perhaps it's not and its simply man made.
Quoting: e.Y.e


What you have is men working in conjunction with these forces so they are "man made" to some extent. Some suspect that what is happening to us happened to them (the greys) and some of them are "slaves" of the fallen angels where others caught on before it was too late and are not and it's them that are warning us. They appear to be "extradimensional" like the fallen angels so they may have experienced a simular deception/infiltration that we are now. Hence the "we oppose deception" message and the simular behavior extradimensionals exhibit. The mark of the beast will pretty much "hardwire" a human to be controlled by these forces. Their promise? Immortality of course; which we already all have. They promise to transfer people into "new" bodies which are basically engineered forms made from all types of things. Cows are a favorite addition to the genetic pool.
Anonymous Coward
User ID: 9380226
United States
03/04/2013 07:14 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
One of the aspects I'm most interested in is our power here and how it appears to be greater than these ancient masters of science/dimensions. They can create some amazingly creepy creatures, change shape,walk through solid object, fly, open dimensional portals and walk in and our of ours, band together to form solid objects and appear as any "alien" type they choose yet if you happen to catch one in process of transforming just the act of watching it and wondering "what is that" completely distrupts the process. There have been many videos of "morphing ufos" that catch this very event. They look like silver bubbles coming out of black clouds. This is what they don't want us to know. They are masters of the universe; WE are masters of the Earth. Hence the reason everything has to be done through man by way of deception and false gifts.
e.Y.e (OP)


User ID: 27484988
United States
03/04/2013 11:21 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
I feel a lot of what you are saying is true.

Last Edited by e.Y.e on 03/09/2013 08:06 PM
e.Y.e (OP)


User ID: 35641286
United States
03/09/2013 08:05 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump

abduct
e.Y.e (OP)


User ID: 35641286
United States
03/10/2013 04:22 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump
e.Y.e (OP)


User ID: 35641286
United States
03/10/2013 05:44 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump
e.Y.e (OP)


User ID: 35641286
United States
03/11/2013 08:17 PM
Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
bump
2be0rnot2be


User ID: 35981829
United States
03/11/2013 08:20 PM

Report Abusive Post
Report Copyright Violation
Re: The Big Picture - Illuminati Inside Info / War / Angels / Demons / Connecting The Dots For You
abduct
101icu
Page 1 2TopPrevious PageNext Page

Back to Forum
Post New Thread
Reply
View Favorites
Create Chat Room

Related Threads
1 NIbiru/Planet-X is on it's way, connect the dots.. NIBIRU FOUND! . 02/17/12
2 BREAKING!!! WANT KNOW THE TRUTH, WE GIVE YOU THE TRUTH. HOLY FUCK, Is Walt Disney and Hitler the same person? VISIT wellaware1 dot com 01/02/12
3 Blue Dots on Mailboxes 08/08/13
4 Must See: police exposes fema: if you find a Red or Blue dot on your mail box:RED means you will be shot immediatly, Blue: you go to fema camp 06/21/13
5 Your Pale Blue Dot 07/22/13
Related Topics: Military and War (Mainstream Media) - Illuminati (Secret Societies) - View ALL Secret Societies (Secret Societies)

News
Light Slowed to a Crawl in Liquid Crystal Matrix
Extinctions Can Cut Earth's Nutrient Flow
Wireless devices go battery-free with new communication technique
Member of Congressional Science Committee: Global Warming a ‘Fraud’ to ‘Create Global Government’
Sun Will Flip Its Magnetic Field Soon
Global cooling, not warming, is Earth’s coming threat
‘Bloomburgernator’ robots force humans to eat artificial protein patties
The Fed’s Confession: We Can Avoid A Crash At The End Of QE If Everybody Believes That Everybody Believes In A Mirage....
What Papa John's Doesn't Want You to Know About Their Food
Build a $300 underground greenhouse for year-round gardening (Video)
What’s in Your Condiments?
Algae suit generates food to feed your constant hunger
The Ultimate Apocalypse Cuisine: A 12-Course Meal in a Can
Forget Student Loans…Introducing Day Care Loans
Robot Programmed to Fall in Love with a Girl Goes too Far
Surfer Dude Buys Sushi, Lobster, Avoids Work
U.S. Pays $1.5 Mil to Help Brazilian Women Quit Smoking
Obamacare ’s “Affordable” Care Costs – $1 Increase In Annual Pay Could Cost Your Family $9,355 In Additional Premiums
Hackers who targeted media last year now targeting think tanks
DC Speeding Ticket Camera Company Is Doctoring Evidence Photos
Strip Club Owner Brings Epic Free Speech Fight To The US Supreme Court - that taxes on lap dances should be illegal
Homeowner files class action lawsuit to stop smart meters
Remember what the Internet was like in 1997?
The DNA Nanobots Have Arrived
Forget REAL ID -- The Global Smart-ID is coming!






Disclaimer / Copyright Info - Privacy Policy - Terms Of Use

Mail Webmaster with questions or comments about this site.

"Godlike Productions" & "GLP" are registered trademarks of Zero Point Ltd.
Website Design Copyright © 1999 - 2012 Godlikeproductions.com
Page generated in 0.213s (18 queries)

march 20 2010


HOME
SECRET SOCIETIES
END TIMES
YHWH
BLOG
WORKS
CONTACT ME
ABOUT
ILLUMINATI
Michael Jackson
June 25th, 3 days after the summer solstice, the "King of Pop" suddenly dies after days of preparation for his last tour "This is It" in London, a key city. I couldn't help but feel like it meant something in a way but I tried not to think to much about it until my friend who's name happens to be also Michael asked me if I thought anything special of it; here it is what I could come up with.



Summer Solstice
A few days after the summer solstice which is a big date, two different famous people died, one of them being Farrah Fawcett one of "Charlie's Angels", so in a sense, before Jackson was gone the same morning an "angel of Charlie" fell or why not "sent back to heaven", maybe to send a message(i.e angel=messenger).

The meaning of Charles is:

Usage: English, French
From the Germanic name Karl, which was derived from a Germanic word which meant "man". However, an alternative theory states that it is derived from the common Germanic element heri meaning "army, warrior", others "Farmer".

"An Angel of Man" or messenger was sent back that morning, then Michael was coming behind. First let me say that it should be very clear that Michael Jackson's death alone is creating a buzz in the media all around the globe so overwhelming that makes it seem like it may have been planned out for the eyes and "hearts" of the people to be focus on MJ and not on what the world leaders are doing behind the scenes with our world, because let me repeat that Jackson's death is a worldwide event used for worldwide change of the system.



The Name "Michael Jackson"
Let's see the spiritual or ritualistic aspect of his death, by seeing the meaning of the name which is the essence of who you are in one word, the reason why I am so zealous to maintain the Awesome Name of my Savior and Messiah Yahushúa and of the Father Almighty YHWH pure, and not the world's corrupted words Jehovah Jesus.

MICHAEL
Usage: English, German, Czech, Biblical

Pronounced: MIE-k?l (English), MI-khah-el (German) [key]
From the Hebrew name (Mikha'el) meaning "who is like God?". This is a rhetorical question, implying no person is like God. Saint Michael was one of the seven archangels in Hebrew tradition and the only one identified as an archangel in the Bible. In the Book of Revelation in the New Testament he is portrayed as the leader of heaven's armies, and thus is considered the patron saint of soldiers.


Daniel 12:1
“At that time Michael shall stand up,
The great prince who stands watch over the sons of your people;
And there shall be a time of trouble,
Such as never was since there was a nation,
Even to that time.
And at that time your people shall be delivered,
Every one who is found written in the book.



Maybe because of this promise or prophecy, they decided to kill a Michael at the beginning of their ultimate rebellion against the Almighty, YHWH.



Revelation 12:7
And there was war in heaven. Michael and his angels fought against the dragon, and the dragon and his angels fought back.



There are scriptural reference to say that Yahushúa the image of YHWH who walked the earth and is to come back carries also the name Michael as the heavenly chief.



"The term "archangel" is another shoddy Greek transliteration of arXaggelos. It means Chief Envoy. There is only One Chief Envoy. The Chief of the envoys is Yâ-hwéh, as they are the envoys of Yâ-hwéh. Somehow many have lost sight of this. Scripture calls the Chief of the envoys Miykhâ'Ë´l (Michael). None of the others are called this term, Chief Envoy ("archangel"). This name, or title, means Miy (He Who) - kha (is like) - 'Ël (the Mighty One [singular meaning the Father]). Who is the Tmunath Yâ-hwéh (“express Image” of the Father)? Who is like the Mighty One? Who is the only One Who is like Him?"
Taken from, Yahuwshua.org



The meaning of the name is an important one, one of which I'm sure Illuminati would love to make use of when sacrificing blood for some power or influence of the dark powers to meet their goals according to plan. Lets not stop there though, his last name is maybe as important as the first one, as we'll see.



JACKSON
Surname Meaning & Origin:
This patronymic surname means "son of Jack." The given name Jack may be a diminutive of John or James, or a derivation of the Old French given name Jacque, the French form of Jacob.



Therefore the name Michael Jackson can be translated as "Who is like God? the Son of Jacob".

It is a big deal, when you think about the fact that Jacob is he who became Israel the Father of the real nation of YisraEl, so in a way Yahushúa the real Messiah can be called the Son of Jacob because of him being a descendant of course.

The throne of England is on top of what they say is "the Stone of Destiny" or "Pillow of Jacob" which is the rock where Jacob rested his head when he saw the Angel of YHWH at the top of a ladder by which many angels where coming up and down, he anointed that stone and pronounced a blessing.


Genesis 28:10-22

Jacob’s Vow at Bethel

10 Now Jacob went out from Beersheba and went toward Haran.
11 So he came to a certain place and stayed there all night, because the sun had set. And he took one of the stones of that place and put it at his head, and he lay down in that place to sleep.
12 Then he dreamed, and behold, a ladder was set up on the earth, and its top reached to heaven; and there the angels of YHWH were ascending and descending on it.
13 And behold, YHWH stood above it and said: “I am YHWH Mighty One of Abraham your father and the Mighty One of Isaac; the land on which you lie I will give to you and your descendants.
14 Also your descendants shall be as the dust of the earth; you shall spread abroad to the west and the east, to the north and the south; and in you and in your seed all the families of the earth shall be blessed.
15 Behold, I am with you and will keep you wherever you go, and will bring you back to this land; for I will not leave you until I have done what I have spoken to you.”
16 Then Jacob awoke from his sleep and said, “Surely YHWH is in this place, and I did not know it.”
17 And he was afraid and said, “How awesome is this place! This is none other than the house of YHWH, and this is the gate of heaven!”
18 Then Jacob rose early in the morning, and took the stone that he had put at his head, set it up as a pillar, and poured oil on top of it.
19 And he called the name of that place Bethel;[a] but the name of that city had been Luz previously.
20 Then Jacob made a vow, saying, “If YHWH will be with me, and keep me in this way that I am going, and give me bread to eat and clothing to put on,
21 so that I come back to my father’s house in peace, then YHWH shall be my Mighty One.
22 And this stone which I have set as a pillar shall be YHWH's house, and of all that You give me I will surely give a tenth to You.”



The stone is there because they believe to be the rightful owners of the Kingdoms of the earth, therefore even the kingdom of King David who is also "the Son of Jacob", they are expecting to give that throne to their messiah soon, as I believe it to be in exactly 3 years and a half from the day of the ritualistic death of Michael Jackson = "Who is like God? the Son of Jacob", many believe this "Antichrist" is Prince Charles, cause is "a name of Man", others believe that instead it is his son William, who will do his own Will, the Will of I Am, which could be consider a blasphemy name.

Going even deeper into it, in the spiritual sense when it is spoken of the nation of Jacob, name which means "supplanter", it refers to the nation who still follows the supplanter cause they refuse to change the name they call upon, from Jesus to Yahushúa, just like Jacob the "Supplanter" became YisraEl, which means "He who will rule like the Mighty One".



H3290
יעקב
ya‛ăqôb
yah-ak-obe'
From H6117; heel catcher (that is, supplanter); Jaakob, the Israelitish patriarch: - Jacob.

H3478
ישׂראל
yiśrâ'êl
yis-raw-ale'
From H8280 and H410; he will rule as God; Jisrael, a symbolical name of Jacob; also (typically) of his posterity: - Israel.



The King of Pop Dead
The last important factor to take into account is that among many similarities between Elvis' dead and Michael's is that, just like Elvis was called the King, so was Michael Jackson called the King of Pop. When Freemasons and other ritualistic orders do their blood sacrifices to their god, killing "a king" means a lot, because their god will appreciate the blood of such an important person basically the best out of an entire kingdom, in the sense of monarchy, like when they took Kennedy out, the king of the United States at the moment, on the street with the shape of a pyramid without the capstone in a Masonic city.



Pop Music
Pop music is a music genre that features a noticeable rhythmic element, melodies and hooks, a mainstream style and a conventional structure. The term "pop music" was first used in 1926 in the sense of "having popular appeal" (see popular music), but since the 1950s it has been used in the sense of a musical genre, originally characterized as a lighter alternative to rock and roll.



At the end of all these, thinking of how Doctors have said he was healthy, the fact that he was only 50 years old and they are now saying that it could've been an overdose provided by his own doctor, I have come to conclude, that Michael Jackson was a victim of an Illuminati Ritual, The King of Popular appeal, the "King of the People", they are now going to get rid of the people under the king, like it is normally done in a war.

The "Angel of the man" left that morning to then finish it off with "Who is like God? the Son of Jacob" the world acclaimed "King of the Population", as a subliminal message to come for the rest of the population, keeping the minds of the world busy on his death while they do what they have been planning for so long for these days.

Be ready prepare and open your eyes.






"They Don't Care About Us"

Skin head, dead head
Everybody gone bad
Situation, aggravation
Everybody allegation
In the suite, on the news
Everybody dog food
Bang bang, shot dead
Everybody's gone mad

All I wanna say is that
They don't really care about us (Illuminati)

Beat me, hate me
You can never break me
Will me, thrill me
You can never kill me
Jew me, sue me
Everybody do me
Kick me, kike me
Don't you black or white me

Tell me what has become of my life
I have a wife and two children who love me
I am the victim of police brutality, now
I'm tired of bein' the victim of hate
You're rapin' me of my pride
Oh, for God's sake
I look to heaven to fulfill its prophecy...
Set me free

Tell me what has become of my rights
Am I invisible because you ignore me?
Your proclamation promised me free liberty, now
I'm tired of bein' the victim of shame
They're throwing me in a class with a bad name
I can't believe this is the land from which I came
You know I do really hate to say it
The government don't wanna see
But if Roosevelt was livin'
He wouldn't let this be, no, no

Some things in life they just don't wanna see
But if Martin Luther was livin'
He wouldn't let this be


"They Don't Give A Fuck About Us"

Y'all ain't never just tripped and pictured
And just looked at the whole situation
Cause once u look at it
You know
(really do)

They don't give a fuck about us
They don't give a fuck about us
They don't give a fuck about us

Thuggin' till the day I die
They don't give a fuck about us
And when I start to rise
A hero in their children's eyes
Now they give a fuck about us

[Tupac]
Some say niggaz is hard headed cause we love to trick
Equipped with game so we bang wit this thuggish shit
I see you trying to hide
Hoping that nobody don't notice
You must always remember you still a member of the hopeless
See ya black like me
So you snap like me
When these devils try to plot
Trap our young black seeds
Look it
Cops are just as crooked as the niggas they chasin'
Lookin' for role models
Our father figures is bases
Some say they expect Illuminati take my body to sleep
Niggas at the party with they shotties
Just as rowdy as me
Before I flee computer chips
I gotta deal wit brothas flippin
I don't see no devils bleedin'
Only black blood drippin
We can change
Whatcha now say?
I'm watchin niggaz work their lives out without pay (huh)
Whatever it takes to switch places wit the bustas on top
I'm bustin' shots make the world stop
They don't give a fuck about us

[Tupac]
I'm seeing it clearer
Hating the picture in the mirror
They claim we inferior
So why the fuck these devils fear ya?
I'm watching my nation die genocide the cause
Expect a blood bath
The aftermath is y'alls
I told ya last album, we need help cause we dying
Give us a chance, help us advance cause we trying
Ignore my whole plea, watching us in disgust
And then they beg when my guns bust
They don't give a fuck about us



Read update here...

Michael Jackson, Victim of the Illuminati

CONTACT ME
Using the contact form to send us email at below

SUBMIT
KEEP IN TOUCH WITH ME

Contact me if you have any questions or information you may want to share. Available for booking Internationally, for Hip Hop events and speaking at Churches or Public events about the information on the site, Secret Societies such as the Illuminati and Bible Prophecies of the End Times coming to fulfillment.
Name: Koresh
Skype: sirius.thedoggstar
Subscribe to our mailing list

FacebookTwitterYoutubelinkedInSoundCloudEmailFeed
Copyright 2012 TheDoggStar.com & Koresh.info All right reserved
Contact

VIDEO

THE SIGNS OF THE END
We are now living in the time period known in Scripture as the “Last Days” or the “Time of the End”, that is, the era which immediately precedes the Second Coming of Jesus Christ!
Skip to content
HOMEINDEX OF VIDEOS AND ARTICLESABOUT
The Secret Illuminati – Aliens are Fallen Angels


What does the Bible say about UFOs, aliens, alien abductions? Are “aliens” demons in disguise attempting to deceive the world into believing they are our creators and saviors? “Aliens” are giving messages to their human contacts that are anti-biblical, deny Christ and his work on the cross. Sounds like a demonic agenda.





Share this:


Share on Tumblr

More
Like this:
This entry was posted in The Signs Of The End, Videos and tagged events, god, media, news, people, politics, research on April 4, 2013 by frederickolson.
About frederickolson
I'm just a nobody telling anybody about SOMEBODY that can save everybody! There, but for the grace of God, go I
View all posts by frederickolson →
Post navigation← Weapons_of_Mass_DeceptionDOLLAR COLAPSE IS THE END AS WE KNOW IT BUT SAME FOR THIRD WORLDERS →
DISCLAIMER

This site may not endorse, in whole, the posts of other authors appearing here. This site may not share, in their entirety, other authors' expressed opinions, views, and beliefs. The posts on this site are for information and educational purposes but we advice that you still do further research on the subject. The purpose of the site, is to shed light and inform about people and events that have already happened, are happening, or are about to happen, which the Bible says will "come to pass in the last days" and which are now being fulfilled--to help us discern the "signs of the times" which Jesus and the prophets in the Bible warned about.
INDEX

INDEX OF VIDEOS AND ARTICLES
Economy / 666 / Microchip
New World Order / One World Government
Signs Of The Times
The Devil / Satan / Demons / Nephilim / Aliens
This ‘n That / Jews / Israel / Media
CATEGORIES

Articles (15)
Images (542)
The Signs Of The End (683)
Videos (119)
SIGNS OF THE TIMES!


–Proof that we are living in the Last Days!
THE RISE AND REIGN OF THE ANTICHRIST


–A Time of Great Tribulation!
SIGNS OF THE END


A Bible Study on Matthew 24
LIKE US ON FACEBOOK


TWITTER UPDATES

When Will The Economy Collapse? wp.me/p2j7Jb-QN
1 week ago
Inside the Homosexual Agenda wp.me/p2j7Jb-QJ
1 month ago
Israel - Occult Zionism - Hell on Earth - Documentary - WW3 - NWO wp.me/p2j7Jb-QF
2 months ago

Join 2,502 other followers





BLOG STATS

20,630 views
ACKNOWLEDGMENT

If you hold the copyrights to any of the material posted here and would like for it to be attributed to you, or removed... please let us know.
LINKS

Free Bible Studies Online Website
Free Bible Studies Online Blog
This, That ‘n Health
META

Register
Log in
Entries RSS
Comments RSS
WordPress.com
The Twenty Twelve Theme. Blog at WordPress.com.
Follow
Follow “THE SIGNS OF THE END”

Get every new post delivered to your Inbox.

Join 2,502 other followers

APRIL 4TH 2013

Powered by WordPress.com


THE SIGNS OF THE END
We are now living in the time period known in Scripture as the “Last Days” or the “Time of the End”, that is, the era which immediately precedes the Second Coming of Jesus Christ!
Skip to content
HOMEINDEX OF VIDEOS AND ARTICLESABOUT
The Secret Illuminati – Aliens are Fallen Angels


What does the Bible say about UFOs, aliens, alien abductions? Are “aliens” demons in disguise attempting to deceive the world into believing they are our creators and saviors? “Aliens” are giving messages to their human contacts that are anti-biblical, deny Christ and his work on the cross. Sounds like a demonic agenda.





Share this:


Share on Tumblr

More
Like this:
This entry was posted in The Signs Of The End, Videos and tagged events, god, media, news, people, politics, research on April 4, 2013 by frederickolson.
About frederickolson
I'm just a nobody telling anybody about SOMEBODY that can save everybody! There, but for the grace of God, go I
View all posts by frederickolson →
Post navigation← Weapons_of_Mass_DeceptionDOLLAR COLAPSE IS THE END AS WE KNOW IT BUT SAME FOR THIRD WORLDERS →
DISCLAIMER

This site may not endorse, in whole, the posts of other authors appearing here. This site may not share, in their entirety, other authors' expressed opinions, views, and beliefs. The posts on this site are for information and educational purposes but we advice that you still do further research on the subject. The purpose of the site, is to shed light and inform about people and events that have already happened, are happening, or are about to happen, which the Bible says will "come to pass in the last days" and which are now being fulfilled--to help us discern the "signs of the times" which Jesus and the prophets in the Bible warned about.
INDEX

INDEX OF VIDEOS AND ARTICLES
Economy / 666 / Microchip
New World Order / One World Government
Signs Of The Times
The Devil / Satan / Demons / Nephilim / Aliens
This ‘n That / Jews / Israel / Media
CATEGORIES

Articles (15)
Images (542)
The Signs Of The End (683)
Videos (119)
SIGNS OF THE TIMES!


–Proof that we are living in the Last Days!
THE RISE AND REIGN OF THE ANTICHRIST


–A Time of Great Tribulation!
SIGNS OF THE END


A Bible Study on Matthew 24
LIKE US ON FACEBOOK


TWITTER UPDATES

When Will The Economy Collapse? wp.me/p2j7Jb-QN
1 week ago
Inside the Homosexual Agenda wp.me/p2j7Jb-QJ
1 month ago
Israel - Occult Zionism - Hell on Earth - Documentary - WW3 - NWO wp.me/p2j7Jb-QF
2 months ago

Join 2,502 other followers





BLOG STATS

20,630 views
ACKNOWLEDGMENT

If you hold the copyrights to any of the material posted here and would like for it to be attributed to you, or removed... please let us know.
LINKS

Free Bible Studies Online Website
Free Bible Studies Online Blog
This, That ‘n Health
META

Register
Log in
Entries RSS
Comments RSS
WordPress.com
The Twenty Twelve Theme. Blog at WordPress.com.
Follow
Follow “THE SIGNS OF THE END”

Get every new post delivered to your Inbox.

Join 2,502 other followers





Powered by WordPress.com

march 1ST 2013

VIDEO ILLUMINATI STARS BEFORE AND AFTER (Caution Disturbing scenes)


https://www.youtube.com/watch?v=fD4Vgq-duwM

VIDEO FRANCAIS

Illuminatis - Repérez les signes et symboles sataniques chez les stars


... EST PARTOUT

https://www.youtube.com/watch?v=THzZvgbMd9E